KEGG   Salmonella enterica subsp. arizonae: SARI_03676Help
Entry
SARI_03676        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SARI_03676
   01212 Fatty acid metabolism
    SARI_03676
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SARI_03676
   00650 Butanoate metabolism
    SARI_03676
  Lipid metabolism
   00071 Fatty acid degradation
    SARI_03676
   01040 Biosynthesis of unsaturated fatty acids
    SARI_03676
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SARI_03676
   00310 Lysine degradation
    SARI_03676
   00380 Tryptophan metabolism
    SARI_03676
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SARI_03676
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SARI_03676
   00281 Geraniol degradation
    SARI_03676
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SARI_03676
   00930 Caprolactam degradation
    SARI_03676
Enzymes [BR:ses01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SARI_03676
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SARI_03676
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SARI_03676
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     SARI_03676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3606009..3608276
Genome map
AA seq 755 aa AA seqDB search
MHFFNTKYTLRFIWYDQITLWIQETDMLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTA
TVASLGQALDVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSV
FNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRL
PRMLGADSALEIIAAGKDVGAEQALKIGLVDGVVKQEKLIEGAMAVLRQAIVGDLDWKAK
RQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTIEAAARFGRDEALNLEN
KSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAW
KGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVD
VVVEAVVENPKVKKAVLAETEQKVRPQTVLASNTSTIPIGELASALERPENFCGMHFFNP
VHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLL
RDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDA
LFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVNQPKRDFSDDEIIARMMIP
MINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQGSAKYLDIAQQYQHLG
PLYEVPEGLRNKARHNEPYYPPVEPARPVGSLKTA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
ttgcatttttttaacacaaaatacacacttcgtttcatctggtacgaccagatcaccttg
tggattcaggagactgacatgctttacaaaggcgacaccctgtacctcgactggctggaa
gatggcatcgccgaactggtgttcgatgctcccggctcggtcaataaactcgacactgcg
accgtcgccagcctcggccaagcgcttgatgtgctggaaaagcaacacgatttaaaaggg
ctgctgctacgttccaataaagcggcctttattgtcggcgcggacatcaccgaattcctt
tcactgttcctcgtacccgaagagcagttaagccaatggctacatttcgctaacagcgtc
tttaaccgtctggaagatttacccgtaccgacccttgccgccgtaaacggctatgcgctg
ggcggcgggtgcgaatgcgtgctggcgaccgattaccgtctggcaacgccagaccttcgt
attggtctgccggaaaccaaactgggcatcatgccgggctttggcggttccgttcgtctg
ccgcgcatgctgggcgccgacagcgcgctggaaattatcgcggcgggtaaagatgtcggt
gctgaacaagctctgaaaatcggcctggttgatggtgtggtcaaacaagagaagctgatt
gaaggcgcgatggcggtgttacgtcaggccattgtcggcgaccttgactggaaagccaaa
cgtcaaccgaagctggaaccgttgaagctcagtaagattgaagcggcgatgagcttcacc
attgccaaaggaatggtcgctcaaacggcaggcaaacactatccggcgccgatgaccgca
gtgaaaaccattgaagcggccgcgcgttttggccgtgacgaagcgctcaacctggaaaac
aaaagttttgtcccgctggcgcataccaacgaggctcgcgctctggtcggcatcttcctc
aacgatcagtatgtaaaaggcaaagccaaaaagctgaccaaagatattgagacgccgaaa
caggcagccgtactgggcgcgggcattatgggcggcggtatcgcttaccagtcggcctgg
aaaggcgtaccggtcatcatgaaagatatcaacgataaatcgttgaacctcggcatgacc
gaagcggctaagctgctgaacaaacaactggagcgcggcaagatcgacggtctgaagctg
gcgggcgtcatttcgaccatccacccgactctcgattatgccggtttcgatcgcgtagat
gttgttgtcgaagcggtggtcgaaaatccgaaagtcaaaaaagcggtactggcggaaacc
gagcagaaagtgcgcccgcaaaccgtgctggcctcaaatacctccaccatcccgattggc
gaactggcaagcgccctggaacgtccggaaaacttttgcggaatgcactttttcaacccg
gtacaccggatgccgctggttgaaatcattcgcggcgagaagagttcagacgaaaccatt
gccaaagtcgtcgcctgggcaagcaaaatgggcaagacgccgattgtagtcaacgactgc
cccggcttctttgttaaccgcgtgctgttcccctatttcgccggtttcagtcaactgctg
cgcgacggcgcggatttccgcaaagtcgataaagtgatggaaaaacagttcggctggccg
atgggcccggcctatctgctggatgttgtcggcattgataccgcgcatcacgcgcaggcg
gtaatggcggcaggcttcccgcaacggatgcagaaagagtatcgcgacgcgatcgacgca
ttgtttgacgccagccgttttgggcaaaaaaacggtctgggcttctggcgctataaagaa
gacagcaagggtaagccgaagaaagaagaagatgccgctgtggatgacctgctggcaagc
gtcaatcagccgaaacgcgacttcagcgacgacgagataatcgcccgtatgatgatcccg
atgattaacgaagtggttcgctgtctggaagaaggcattatcgcaagcccggcggaagct
gatatggcgctggtctacggcctgggcttccctccgttccacggcggcgcattccgctgg
ctggatacacagggcagcgcgaaatatcttgatatagcgcagcagtatcaacacctcggc
ccgctgtatgaggtgccggaagggctgcgtaataaagcgcgccataacgaaccgtattat
cccccggttgaaccagcccgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system