KEGG   Salmonella enterica subsp. arizonae: SARI_03824Help
Entry
SARI_03824        CDS       T00627                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ses  Salmonella enterica subsp. arizonae
Brite
Enzymes [BR:ses01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SARI_03824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3758588..3759988
Genome map
AA seq 466 aa AA seqDB search
MKKITLYATTVITVGLLCYLGLSGYVWFHDKQRSKKNDVQASVVGENNKILGYFREKGCD
YCHTPSAELPFYSSFPVAKQLMDYDIQLGYKSFNLEAVRAALIADTPVPQSELNKIEWVM
QHQTMPPTRYVALHWAGGVSDKERTDILNWIADQRERNYASADTDAAHRNEPVQPIPRNI
PVDAKKVDLGFRLYHDERLSGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRAATLQAQAGGPPLNPIEMASKSWDEIISKLDKDPVLKKDFQAVYPQG
FTGENITDAIAEFEKTLITPDSAFDKWLRGDENALTAQQKHGYQLFKENKCATCHGGIIL
GGRSFEPLGLKRDFNFGEITAADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGADLPQNDIDDIVAFLESLTGVYTPYQPEYVQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaccctctatgcgacaacggttatcaccgttgggctgttatgttattta
ggtttgtccgggtatgtatggtttcatgacaaacagcgtagtaaaaaaaacgatgtgcag
gcctctgttgtgggagaaaataacaaaatacttggttatttcagggagaaaggatgtgat
tattgtcatacgccttccgctgaattgcctttttattcctcttttccggtagcaaagcag
ctaatggattacgacatccagctcggctacaaatcgtttaacctggaggcggtacgggcc
gccctgatcgctgatacgcctgtgccgcaaagcgaactgaataaaattgaatgggttatg
caacatcagactatgccgccaacccgctatgtcgcactgcactgggcggggggcgtcagc
gataaagagcgcactgacatcctgaactggatagccgatcagcgtgagcgtaactatgcc
agcgccgacaccgacgcagcgcaccggaatgaacccgttcagcctattccgcgcaatatt
cccgtcgatgcgaaaaaagtcgacttaggtttccgtctttatcatgatgaacgtttatcc
ggcgacagcacaatatcctgtgcgcattgtcacgcgttaaatgcgggcggcgtcgatggc
agaaaaacttcaattggcgttggcggtgcggtaggaccaataaatgcgccaacggtgttc
aattccgtatttaatatcgaacaattctgggatggtcgtgctgcaaccctgcaggctcaa
gcaggcggaccgccattaaatcccatcgaaatggcatctaaatcctgggatgaaattatt
agcaaacttgataaagatcctgtcctgaaaaaagatttccaggcggtttatccgcaagga
tttaccggggaaaatattaccgatgcaatcgctgagtttgaaaaaacgctgataacaccg
gattccgcctttgataaatggttacgtggagatgaaaatgcgctgactgcgcaacagaaa
cacggttatcaattatttaaagagaataaatgtgcgacctgtcacggcggtatcatttta
ggcggacgctcttttgaaccattgggattaaagcgagactttaattttggcgaaattacc
gcagcggatattggtcgtatgaacgtaaccaaagaggttcgcgataaattacggcaaaaa
gtccctggcttacgcaacgtcgcgctcacggcgccttatttccaccggggcgacgtaccg
acgctggatggcgcggtaaaactgatgttgcgttatcaggttggcgccgatctgccgcaa
aacgatattgatgatatcgtcgccttcctggaaagcctgaccggtgtttatacgccctat
caacctgaatatgtgcaatga

DBGET integrated database retrieval system