KEGG   Salmonella enterica subsp. arizonae: SARI_03856Help
Entry
SARI_03856        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SARI_03856
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SARI_03856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ABX23650
UniProt: A9MKI1
Position
3787396..3788316
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIILQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDSSDRIRAAARSLVDKGLNNIIVTMGEKGALWMTRDKEVHVPAF
NVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
YLSLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttattggctctaacatggtggaccttatcacctacaccaaccagatg
cccaaagaaggggaaactctggaagcgccagcgtttaaaatcggctgcggcggaaaaggg
gcgaaccaggcggtggcggccgctaagctcaattcaaaagtcttgatgctgaccaaagtg
ggcgacgatatttttgccgacaacaccattcgtaatctcgaatcctggggtatcaacacg
acgtatgtggaaaaagtaccgtgtaccagcagcggcgtagcgccgattttcgtcaatgcc
aattccagcaacagcattctgatcatcaaaggcgcaaacaagtttctctcgccggaagat
atcgatcgcgcggcggaagatttaaaaaaatgccagcttattattctgcaactggaagtt
cagcttgaaacggtttaccacgcaatagaatttggcaagaaacacgggattgaagtgtta
ttaaatcctgcgcccgcattacgggaattagatatgtcttatgcctgtaaatgcgacttc
tttgtacccaacgaaaccgaactggaaatattaacgggtatgccggttgattccagcgat
cgtattcgcgcggcggcgcgttcgctggtggataaagggctgaataatattattgttacg
atgggcgaaaagggcgcgctatggatgacgcgtgacaaggaagtacacgttccggcgttt
aacgttaatgctgtcgataccagcggcgcgggcgatgcttttatcggctgtttcgcgcat
tactatgtccagagcggagatgtggaagccgccatgaaaaaagccgtcctctttgccgct
ttcagcgtcaccgggaaaggcacccaatcctcttatccaagcattgagcaatttaatgag
tatctttcgttgaacgaataa

DBGET integrated database retrieval system