KEGG   Salmonella enterica subsp. arizonae: SARI_03976Help
Entry
SARI_03976        CDS       T00627                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ses00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ses00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3909942..3911276
Genome map
AA seq 444 aa AA seqDB search
MELTMQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNG
ADMFGVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYK
NNFAQMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPDVFSWAATQVVTAMNA
THKLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQ
EPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVD
ANRGDAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALSLKIAARMVEDGELDKRVAKRYAGWNGELGQQILKGQLSLGELAQYAEQHN
LAPVHQSGHQELLENLVNRYLFDK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagctcactatgcaggcttattttgaccaactcgatcgcgttcgctatgaaggccct
caatcgactaacccgctggcatttcgtcattacaatcccgatgagctggttttaggcaaa
cgtatggaagatcacctgcgtttcgcggcctgttactggcataccttctgctggaacggc
gcggatatgtttggcgtgggagcgtttaatcgtccgtggcagcaaccgggtgaagccctg
gaactggcgaaacgtaaagcggacgtggcgtttgaatttttccataaactgaatgtgcct
ttttattgcttccatgatgtggatgtgtcgccagaaggcgcgtcgttgaaagagtataaa
aacaacttcgcgcagatggtggatgtactggcggcaaaacaggagcagagcggcgtaaaa
ctgctgtggggaacggcgaactgctttaccaatccgcgttatggcgcaggcgccgctact
aatccggacccggatgtctttagctgggctgcgacgcaagtggtaacggcaatgaacgcc
acgcataaactgggcggcgaaaactacgtactgtggggcggacgcgaaggctacgaaacg
ttgctgaataccgatctgcgccaggaacgcgaacagattggccgttttatgcaaatggtg
gtcgagcacaagcataaaatcggtttccaggggacgctgctgattgaaccgaaaccgcag
gaaccgacaaaacatcagtatgattatgatgttgcaacggtctatggtttccttaaacag
ttcggtctggaaaaagagatcaaagtgaatattgaggcgaaccatgcgacgctggcgggc
cactcgttccaccatgagatcgccactgctatcgcgctgggtatttttggctccgttgac
gccaaccgcggcgatgcgcaactgggctgggataccgatcagttccccattagcgttgaa
gagaacgcgctggtgatgtacgaaattctgaaagcgggcgggttcaccacgggcggcctc
aacttcgacgccaaagtccgtcgccagagtaccgataaatacgatctgttctacggtcat
atcggcgcgatggatacaatggctctgtcgctgaaaatcgccgcgcgtatggtcgaagac
ggcgaactggataaacgcgtggcgaagcgctacgccggctggaatggcgaactgggacag
caaatcctgaaagggcagctctccttaggcgagctggcgcagtatgcggagcagcacaac
ctggcaccggtacatcaaagcggtcatcaggaactgttagaaaatctggttaaccgttat
ctgtttgataaataa

DBGET integrated database retrieval system