KEGG   Salmonella enterica subsp. arizonae: SARI_04090Help
Entry
SARI_04090        CDS       T00627                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ses00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4030921..4033107
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTQSEERQKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDDFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFSGVTRPPETGGLGFWFK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKAGNEIIVASNFTPV
PRYDYRFGVNQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGRQHSLRLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaggccggactggaagtccgcgccctatta
cctgacgccaccgacgtatgggtgattgaacccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgacgctcgcggttttttctgcggcgttttaccccgacgtaaaaatttcttt
cgctatcagctcgccgtggtctggcacggacagcagaacctgatcgacgatccttaccgt
tttggcccattgatccaggaaatggatgcctggctgttgtcggaaggcactcacctgcgt
ccttatgaaacgctgggcgctcacgccgatacgatggacggcgtcaccggcacccgtttt
tccgtctgggcgcctaatgctcgtcgtgtttcggttgtcgggcaatttaactattgggat
gggcgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatcccc
ggcgcgcataatgggcaactgtataaattcgagctgcttgatgctaacggtaatctgcgc
attaaagccgatccctatgcttttgaggcacagatgcgtccggaaacggcgtcgatgatc
tgcggactgccggaaaaagtgacgcaaagcgaagaacgacaaaaggccaatcagtttgat
gcgccgatctctatttatgaggtgcatttaggttcatggcgtcgccatacggataataac
ttctggctaagctatcgtgaactggcggatcagctcgtaccttacgccaaatggatgggc
tttacgcaccttgaactcttgccggtcaacgaacatccgtttgacggcagttggggctac
cagccgaccggcctctacgcgccgacccgccgctttggtacgcgggatgacttccgctat
ttcatcaacgcggcccatgcggcggggctcaatgttattctcgactgggtgccgggccat
ttcccgtccgatgattttagccttgcggagtttgacggcacccacctctatgagcacagc
gacccgcgcgagggctatcatcaggactggaatacgctgatctacaactatggtcgtcgt
gaagtcagtaactatctggtgggcaacgccctatactggatggaacgttttgggattgat
gcgctgcgtgtcgatgctgtggcctctatgatctatcgcgactacagccgcaaagaaggc
gagtggatcccgaacgagtttggcggtcgtgaaaatctggaagccattgagtttctacgt
aataccaaccgtattattggcgagcaggtgcccggcgcggtcagcatggcggaagagtcg
acagacttctctggcgtgacgcgtccgccggaaacgggcggtctggggttctggttcaag
tggaatctgggctggatgcacgacacgctggactatatgaagctggacccggtgtaccgc
cagtatcatcacgacaagctgacctttggtatgttgtacaaccataccgaaaattttgtt
ctgccgctgtcgcacgatgaggtggttcacggtaagaaatccatcctcgatcgtatgccg
ggcgatgcgtggcagaaattcgccaatctgcgcgcctattatggctggatgtgggccttc
cccggtaagaaactgctgtttatgggcaatgagtttgcccaaggacgcgagtggaaccat
gacgccagcctcgactggcacctgctggaagggggcgataactggcaccacggcgttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaggcgctgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgacaacgaacgctcggtactgatt
ttcgtgcgccgcgataaagccggcaacgagatcatcgtcgccagtaactttacgcctgtt
ccccgttacgactaccgctttggcgtcaaccagccgggacgctggcgtgaaattctcaat
accgattcgatgcattatcacggtagcaacaccggcaatggcggcgtggtgcacagcgat
gagatcgaaagccatggccgtcagcactctcttagactgacgttaccgccattggcgacg
atatggctgatgcgggagggggaatga

DBGET integrated database retrieval system