KEGG   Salmonella enterica subsp. arizonae: SARI_04330Help
Entry
SARI_04330        CDS       T00627                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ses00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4251229..4252077
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGATLDLTHPHVMGILNVTPDSFSDGGAHNTLIEAVKHANLMVNAGATIIDVGGE
STRPGAAEVSVEEELDRVIPVLEAIAQRFEVWISVDTSKPEVIREAAKAGAHIINDVRSL
SEPGALEAAAETGLPVSLMHMQGNPKTMQDAPKYDDVFAEVNRYFIEQIARCEKAGIAKA
KLLLDPGFGFGKNLSHNYTLLARLGEFHHFNLPLLVGMSRKTMIGQLLNVGPSDRLNGSL
ACAVIAAMQGAQIIRVHDVKETVEAMRVVEATLSAKGNKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcgctcagggcgccacgctcgatctcactcatccacatgttatgggtatc
ctgaacgtaacgccggattctttctccgacggcggcgcgcataacacgctgattgaggcg
gtgaaacatgcgaatttaatggtgaatgccggggcgacaattattgatgtgggtggtgaa
tcaacgcggccaggcgcggcggaagtgagcgtggaagaagagctggatcgcgtcattccg
gtgctggaagcaatagcgcaacgttttgaagtgtggatttctgtggatacctctaaaccc
gaggtgatccgtgaagcggcaaaggcgggcgcgcatattatcaatgatgtccgttcgctc
tccgagcctggcgcgttggaagccgcggcggaaaccggcttgccggtcagtcttatgcat
atgcagggcaaccccaaaaccatgcaggacgcgccgaaatatgacgatgtctttgccgag
gtgaatcgctactttattgagcaaatagcacgttgtgaaaaggccggcatcgcaaaagcg
aaattgttgctcgaccccggattcggtttcggtaaaaatctctctcacaactatacctta
ctggcgcgattgggtgagtttcatcattttaacctgccgctgctggtgggcatgtcgcgt
aaaacgatgattggtcagctacttaacgtgggaccatcagaccgtctgaacggcagcctt
gcgtgcgcggtaattgccgcgatgcagggcgcgcagatcattcgcgtccatgacgtcaaa
gaaaccgtagaggcgatgcgggtggtagaagccactctgtctgcaaagggaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system