KEGG   Salmonella enterica subsp. arizonae: SARI_04560Help
Entry
SARI_04560        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01480  
agmatinase [EC:3.5.3.11]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SARI_04560
Enzymes [BR:ses01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SARI_04560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4464472..4465323
Genome map
AA seq 283 aa AA seqDB search
MNFQPYESDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHHRFPWNFDMRERL
NVVDCGDLVYAFGDAREMSEKLQAHAEKLLSAGKRMLSFGGDHFVTLPLLRAHAKHFGKM
ALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPHHSVQIGIRTEFDKDNGFTVLDACQ
VNDRGVDDILAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLK
DLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccagccgtatgaaagcgatgccgactgggtgatcactggcgtaccgtttgat
atggcaacgtccggtcgcgctggcggtcgtcatggcccggcggcgatccgtcaggtgtcg
accaacctcgcctgggaacatcaccgtttcccgtggaattttgacatgcgcgagcgcctg
aacgtcgtggactgcggcgatctggtgtatgcgtttggcgatgcccgcgaaatgagtgaa
aaattacaggcgcacgccgaaaaactgctgtctgcgggtaagcgtatgctctctttcggc
ggcgaccactttgtcacgctgccgctgctgcgcgcccatgcgaaacattttggcaaaatg
gcgctggtacattttgacgctcataccgatacctacgctaacggctgcgaattcgatcac
ggcacgatgttctacaccgcgccgaaagaaggcttgatcgatccgcatcattcggtgcag
atcggtatccgcaccgagtttgacaaagacaatggctttaccgtactggatgcctgtcag
gtcaacgatcgcggcgtggatgatatcctcgctcaggtgaaacagatcgtcggcgatatg
ccggtctatctgacctttgatatcgactgtctggacccggcgtttgcgcctggtaccggt
acgccagtgatcggcggtttgacctccgatcgcgccattaaactggtgcgcggtctgaaa
gatctgaacattgtcggtatggatgtggtagaagtcgcgccggcttacgatcagtcggag
atcaccgctctggcggccgcgacgctggcattagaaatgctctatatccaggcggcgaag
aagggcgagtaa

DBGET integrated database retrieval system