KEGG   Salmonella enterica subsp. arizonae: SARI_04599Help
Entry
SARI_04599        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_04599
   00500 Starch and sucrose metabolism
    SARI_04599
Enzymes [BR:ses01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SARI_04599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4504655..4506088)
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTGGAHGVPREITQHVVPGKYYP
NHEAVDFYGHYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDESQPNEAGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQHYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTGHENPEETMYQVLHHQFVASALAVKAARRINPQMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPRYILNEWERRGFTIKMEEGDIE
TLREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMMKAVTWDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKAVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaactcaccttgccaaaagattttttatggggcggcgcggttgccgcacaccag
gtcgaaggcggctggaataaagacggtaaaggtcccagcatctgcgacgtgttaaccggt
ggcgcacacggcgtaccacgggaaatcacccagcacgtcgttcctggcaaatactacccg
aaccacgaggcggtcgatttttacgggcattacaaagaagacatcaggcttttcgccgaa
atggggttcaaatgcttccgtacctctattgcctggacgcgtatcttcccgaatggcgac
gaatcccagccaaatgaagcaggtctgaaattctacgacgacatgtttgatgagttgctc
aaatacaacatcgaaccggtcatcaccctctcccactttgaaatgccgctacatctggta
cagcactacggcggctggaccaatcgtaaagtcgtcgatttctttgtccgttttgctgaa
gtggtgtttgaacgctacaaacataaggtcaaatactggatgaccttcaatgaaatcaac
aatcagcgtaactggcgcgcgccgctgtttggctactgctgttccggcgtggtgtatacc
gggcatgagaatccagaagagaccatgtaccaggtattacatcatcagtttgtcgccagc
gcgctggcggtaaaagcggcccgtcgcattaacccgcagatgaaagtcggctgtatgctg
gcgatggtcgcgctgtaccccttctcctgtaaaccggaagatgtgatgtttgctcaggag
tcgatgcgcgaacgctatgtctttaccgacgtccaactgcgcggctactacccacgttac
atactcaacgagtgggaacgccgcggttttaccatcaaaatggaagagggcgatatagaa
actctgcgcgaaggcacctgcgactatttaggcttcagctactatatgaccaacgcggtc
aaagccgaaggcggtagcggcgatgcgatttccgggtttgaaggcagcgtgcctaacccc
tacgtcaaagcctctgactggggctggcagattgacccggtgggcctgcgctactcattg
tgtgagctgtacgaacgctatcaaaagccgctatttatcgtcgaaaacggctttggcgca
tacgataaggttgaagaggacggcagcatcaatgatgactatcgaattgactatttgcgc
gcgcatattgaagagatgatgaaggctgtaacctgggatggtgtggatctgatgggctac
accccatggggctgtattgactgcgtttcgttcactaccggtcagtacagcaagcgttac
ggctttatctatgtgaacaagcatgacgatggcaccggcgatatgtcacgttcgcgtaag
aaaagttttaactggtacaaagcggtgatcgccagtaacggcgaaaaactgtaa

DBGET integrated database retrieval system