KEGG   Salmonella enterica subsp. arizonae: SARI_04667Help
Entry
SARI_04667        CDS       T00627                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ses03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4568928..4570763
Genome map
AA seq 611 aa AA seqDB search
MTIQKRLLEAVEQKLLRPIDAQFALTVAGNDEPAVTLAAALLSHDAGEGHVCLPLSRLTL
TEEAHPLLVAWISETATPIDWKKRLLASAAVSCGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQAIAVDEDQLSRILDALFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSAIPAGGGAQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSVIRAVFQQGYSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKATPEAILQAFNEYQLLCALREGPFGVRGLNDRVEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFAMPDGAIKSVQPSRLPEHDTTWAMTVHK
SQGSEFDHAALILPNQRSPVVTRELVYTAVTRARRRLSLYADERILAGAIVTRTERRSGL
STLFDEVSHIG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccagaagcggttactggaggccgttgaacaaaaactattacggcccattgat
gcgcagtttgctttaaccgtcgccggtaacgacgagcccgccgtgacgctggcggcagcg
ctgcttagtcatgacgcaggtgaaggtcacgtgtgtctgccgttgtcgcgtttaacgtta
acggaggaggcgcatcccttactggtcgcctggataagcgaaacggctacgccaattgac
tggaaaaaacggttactggcgtctgcggcggttagctgcggcgatagccccgcaccgtta
attctgtgcggcgatcgcctctacctgaatcgcatgtggtgcaacgagcgtacggttgcg
cgcttttttaacgaggttaaccaggccatcgccgtagatgaagatcagttatcccgtatt
ctggacgcgcttttccctccgacagacgaggtgaactggcaaaaggtggccgccgccgta
gcgctaactcgccgtatctccgtgatttcaggcggtcccggcaccggtaaaaccaccacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcggcgccgacggggaaagcggccgcccgcctgacggagtcgctcggcgcggcgttg
cgtcagcttcctcttaccgatgcgcagaaaaagcgtataccggaggacgccagtacgctg
caccgactgctaggcgcacagcccggcagccagcgattacgccatcatgcgggcaacccg
ctgcatctggacgtgctggtggtcgatgaagcgtcaatgattgatttgccgatgatgtca
cgtttgattgacgctctgccgccgcacgggcgggtcatttttcttggcgatcgcgatcag
ctggcatctgttgaggcgggcgctgtattgggcgatatttgcgcctatgtcaacgcaggg
tttacggcagaacgcgcccgacagctaagccgtctaacggggagcgccattccggctggg
ggcggagcgcaagccgcgtctctgcgcgatagcctctgtctgttgcaaaagagctaccgt
ttcggcagcgattccggcatcggaaagctggcggcggcgattaactgtggcgacaggtcg
gtaatccgggctgtctttcagcagggttatagcgatatagaaaaacgtacattacaaagc
agcgacgattatgccgggatgctggatgaagcgctggcgggctatggccgctacctacgg
ttgctgcatgagaaagcgacgccggaggcaatccttcaggctttcaatgagtatcagttg
ctttgcgcgctacgcgaagggccgtttggcgtgaggggattgaatgaccgcgttgagcag
gcgatggttcaacagcgaaaaattcagcggcatccgcattcccgctggtatgagggacgt
ccggtgatgattgcgcgcaacgatagcgcgttggggttatttaacggcgatattggaatt
gcgctcgatcgcgggcagggattgcgcgtctggtttgcgatgccggacggcgcgatcaag
tctgttcagcccagccgcctgccggaacatgacacgacctgggcgatgacggtacataaa
tcgcaggggtctgaatttgatcacgccgcgctgattttacccaaccagcgttcgccggtc
gtaacgcgggaactggtgtataccgctgttacgcgcgcgcggcggcgattatcgctgtat
gccgatgaacggattctggcaggcgcgattgtgacgcgtacggaacggcgcagcgggtta
tcgaccttatttgatgaagtcagtcatatcggataa

DBGET integrated database retrieval system