KEGG   Salmonella enterica subsp. arizonae: SARI_04686Help
Entry
SARI_04686        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00051  Fructose and mannose metabolism
ses01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SARI_04686
Enzymes [BR:ses01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     SARI_04686
    5.3.1.25  L-fucose isomerase
     SARI_04686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N1 Fucose_iso_N2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ABX24450
UniProt: A9MSA6
Position
complement(4585050..4586825)
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALIIEKIRHACGAQVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHNQKGIPAFSIYGHDVQDADDVSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNAQQYKRNEAQNRAVLKESLLMAMCIRDMMQGNKTLADKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFIVATENDSLNGVAMLFGHQLTGTAQIFA
DVRTYWSPEAVERVTGQALNGLAEHGIIHLINSGSAALDGACKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNMIKGLGPVLQIAEGWS
VELPKVMHDQLDARTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDVEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaatcggtatccgcccggtgattgatggacgtcgtatg
ggcgttcgcgagtcgctcgaagagcaaaccatgaatatggcgaaagcgacggcggcgctc
atcatcgagaaaatccgtcacgcctgcggggcacaggtggaatgcgtcattgcggatacc
tgtattgctggtatggcggaatccgccgcctgcgaggagaaattcagcagccagaacgtg
ggcgtaaccattaccgttacgccgtgctggtgctatggcagcgaaaccattgatatggac
ccaatgcgtccgaaagccatctggggctttaacggtacagagcgtccgggggcggtttac
cttgccgcggcgctggcggcgcacaaccagaaaggcattccggcgttctctatttatggt
catgacgtgcaggatgccgacgatgtttccattcccgccgacgttgaagaaaaactgctg
cgttttgcgcgggcaggtttagcggtggccagtatgaaaggcaaaagctacctctccgtt
ggcggcgtgtcgatggggatcgccggttccattgtcgatcataacttcttcgaatcctgg
ctgggcatgaaggtgcaggcggttgatatgaccgaactacgccgccgtatcgatcagaaa
atttatgatgaggctgaactggagatggcgctggcgtgggcggataaaaacttccgctac
ggtgaagatcagaacgcccagcaatataagcgcaatgaagcccagaaccgcgcggtgctg
aaagagagcctgctgatggcgatgtgtattcgcgacatgatgcagggcaacaagacgctg
gcggacaaagggttagttgaagaatcgctgggctacaacgccattgccgccggcttccag
ggccagcgccactggaccgatcaatatccgaacggcgataccgccgaagcgctgctcaat
agctcttttgactggaacggcgtgcgcgaaccgtttatcgtcgccaccgaaaatgacagt
ctgaacggcgtagcgatgctgtttggccatcaactcaccggtaccgcgcagatattcgcc
gacgtgcgaacctactggtcgccggaagctgtcgaacgcgttaccggccaggcgctaaac
gggctggcggaacacggcattattcacctgattaactccggttctgcggcgctggacggt
gcctgtaaacagcgcgacagcgaaggcaagccgaccatgaagcctcactgggaaatcagc
caacaagaggcggatgcgtgtctggcggccactgaatggtgcccggcgattcacgaatac
ttccgcggcggcggctactcatcccgtttcctgaccgaaggcggcgtgccgttcactatg
acccgcgtgaatatgatcaaaggtctggggccggtactgcaaatcgccgaaggctggagc
gtcgaactgccgaaagtaatgcacgatcagcttgatgcccgcaccaactccacctggcct
accacctggtttgcgccgcgtcttaccggaaaaggcccgtttaccgatgtctattccgtg
atggcgaactggggcgctaaccacggcgtactcaccatcggtcatgttggggcagacttt
attactctcgccgcgatgctgcgtatcccggtatgtatgcacaacgtagaggaggcgaag
atctaccgcccttccgcctgggcggctcatggtatggatgtcgaaggccaggattatcgc
gcctgccagaattatggcccgctgtataagcgttaa

DBGET integrated database retrieval system