KEGG   Salmonella enterica subsp. arizonae: SARI_04688Help
Entry
SARI_04688        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00051  Fructose and mannose metabolism
ses01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SARI_04688
Enzymes [BR:ses01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SARI_04688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABX24452
UniProt: A9MSA8
Position
4588735..4589382
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTESHIVFIDA
DGQHEQGKLPSSEWRFHMAAYQTRQDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggcgcggcagattattgatacctgtctggaaatgacgcggtta
gggttaaatcaggggacggccggtaacgtgagtgtgcgttatcaggggggaatgctgatt
acgccgacgggaatcccttacgagaagctgacagagtcgcatattgtctttattgacgct
gacggtcagcatgagcagggcaagctgccttccagcgagtggcgttttcatatggcggca
taccagacgcgccaggatgccaatgccgtggtacataaccacgctgtccattgtacggca
gtctcgatcctgaatcgtccgattccggcgattcactacatgattgccgccgcgggcgga
aactctattccctgcgcgccctacgccacttttggcacccgcgagctttctgaccatgtt
gccgtggcgcttaaaaatcgtaaagcgacgctgctacagcatcacgggcttatcgcttgt
gaggaaaatttagacaaagcgttatggctggcgcatgaggtggaagtactggcgcagctc
tatttaagtacgctggccattgtcgatccggtaccggtactggatgacgaggcgatcgct
atcgtactggagaaatttaaaacttacgggttacgtattgaagagtga

DBGET integrated database retrieval system