KEGG   Saccharothrix espanaensis: BN6_02390Help
Entry
BN6_02390         CDS       T02404                                 

Gene name
recR
Definition
Recombination protein
Orthology
K06187  
recombination protein RecR
Organism
sesp  Saccharothrix espanaensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN6_02390 (recR)
DNA repair and recombination proteins [BR:sesp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BN6_02390 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242493..243086
Genome map
AA seq 197 aa AA seqDB search
MYEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAADPADIGRLQDALQKVKDGVVFCDVCG
NVSAEATCRICRDPRRDLTLICVVEEPKDVLAVERTREFKGRYHVLGGALDPLSGVGPDQ
LRIRQLLTRIGTDVNEIIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPMGGDLE
FADELTLGRALSGRRSM
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaggggccggtccaggacttgatcgacgagctcggcaggctgccgggcgtcggt
cccaagagcgcccagcgcatcgccttccacctgctcgcggcggacccggccgacatcggc
cggctccaggacgccttgcagaaggtcaaggacggggtggtgttctgcgacgtgtgcggc
aacgtctcggccgaggcgacctgccgcatctgccgcgacccgcgccgcgacctgaccctg
atctgcgtggtcgaggagccgaaggacgtgctggcggtcgagcggacccgcgagttcaag
ggccgctaccacgtgctgggcggcgcgctggacccgctgtccggggtggggcccgaccag
ctgcggatccggcagctgctgacccggatcggcacggacgtcaacgagatcatcatcgcc
accgacccgaacaccgagggcgaggcgaccgcgacctacctggtgcggatgctgcgcgac
ttccccggcctgaccgtgacgcggctcgcgtccgggctgccgatgggcggcgacctggag
ttcgcggacgagctcaccctcggccgggcgctgtccggccggcgcagcatgtga

DBGET integrated database retrieval system