KEGG   Saccharothrix espanaensis: BN6_03160Help
Entry
BN6_03160         CDS       T02404                                 

Definition
Glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sesp  Saccharothrix espanaensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN6_03160
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BN6_03160
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN6_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(313520..315268)
Genome map
AA seq 582 aa AA seqDB search
MFRPLVAAAAVAASFVVPPAAAAPTPATPDQSASAQQVRSAVTELAEGLSLEEKVGQLFV
TYLHGQAADEVHPGNQRDFGVGTPAEVIAKYRPGGVVYFNNPSYDNIDTPQQIARLSNGL
QRASRVPLAVATDQETGLVTRIGAPATQFPGNMALGAGRSTRDAERAAAITASELRAMGI
NQNFAPDADVNSNPANPVIGVRSYSSDPALAAEFTAAQVRGYQQRWLSRDSVSATAKHFP
GHGDTDEDSHTTLPVVDRTVEQWRAVDAPPFEAAIRAGIDSVMTAHIRLPRIDPSGEPAT
LSKPAIDLLRNDLGYDGVVITDSLAMAGVRKMHPDAEIPVLALKAGVDQLLMPVDLGLAI
DSVVAAVRSGELTEKRIDQSVLRVLRMKFLRGTLGHPLVDESRVDASVGAPQNLAAAQAI
TDRTITVVRNESLPLKTTLKTTSALVTGWGETTTRTLAGLLGGTALPTGGTPTEAQIAEA
VRAAASADLVVVLTNALSKQPTQQALLTRLLAVGKPVVAVAVQNPYDVAHTAAPNWLATY
SYGAGSMAALAKVITGELKPSGRLPVAVPGPTPYPIGHGVTW
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgtccgctcgtcgccgcagccgcggtcgcggcgtccttcgtcgtgccaccggcc
gccgccgcgccaaccccggccacgcccgaccagagcgcgtccgcgcagcaggtgcgctcg
gcggtcaccgagctggccgagggcctgtccctggaggagaaggtcggccagctgttcgtg
acctacctgcacgggcaggcggcggacgaggtccaccccggcaaccagcgcgacttcggc
gtgggcaccccggccgaggtgatcgcgaagtaccggcccggcggggtcgtctacttcaac
aaccccagctacgacaacatcgacaccccgcagcagatcgcgcgcctgtccaacggcctg
caacgcgcgagccgcgtcccgctggccgtggccaccgaccaggagacgggcctggtgacg
cggatcggcgcgcccgccacccagttccccggcaacatggcgctcggcgcgggccgcagc
acccgggacgccgaacgcgccgccgccatcaccgcgagcgagctgcgcgcgatggggatc
aaccagaacttcgcgccggacgcggacgtcaactccaacccggcgaacccggtgatcggc
gtccgctcctactccagcgacccggcgctggccgccgagttcaccgccgcccaggtgcgc
ggctaccagcagcggtggctgtcacgggactccgtgtcggcgaccgccaagcacttcccc
ggccacggcgacaccgacgaggacagccacaccacgctgcccgtggtcgaccggaccgtc
gagcagtggcgcgcggtcgacgccccgccgttcgaggcggcgatccgcgcgggcatcgac
tcggtcatgaccgcgcacatccggttgccccggatcgacccgtcgggcgagccggcgacg
ctgtccaagcccgcgatcgacctgctgcgcaacgacctcggctacgacggcgtggtcatc
accgactcgctggcgatggcgggcgtgcgcaagatgcacccggacgcggagatcccggtg
ctggcgctgaaggcgggcgtcgaccagttgctgatgccggtcgacctggggctggccatc
gacagcgtggtggccgccgtgcgctccggcgagctgaccgagaagcggatcgaccagagc
gtgctgcgggtgctccggatgaagttcctgcgcgggacgctgggccacccgctggtggac
gagagccgggtggacgcgagcgtcggcgcaccgcaaaacctggccgcggcgcaggcgatc
accgaccgcacgatcaccgtggtgcgcaacgagtcgctgccgctgaagaccacgctgaag
accacatcggcgctggtgaccgggtggggcgagacgaccacccgcacgctggccggcctg
ctcggcggcaccgccctgccgaccggcggcacaccgaccgaagcccagatcgcggaggcc
gtgcgggcggcggcgagcgccgacctggtggtcgtgctgaccaacgcgctgtccaagcag
cccacccagcaggcgttgctgaccaggctgctggcggtcggcaagccggtggtcgcggtg
gccgtgcagaacccgtacgacgtggcgcacaccgccgcgccgaactggctggcgacctac
tcctacggggccggttcgatggcggcgctggcgaaggtgatcaccggcgagctgaagccc
agcggtcggttgccggtcgccgtccccgggccgacgccgtacccgatcggccacggggtg
acgtggtga

DBGET integrated database retrieval system