KEGG   Saccharothrix espanaensis: BN6_03510Help
Entry
BN6_03510         CDS       T02404                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00790  Folate biosynthesis
sesp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN6_03510
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BN6_03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI AAA_22
Motif
Other DBs
NCBI-ProteinID: CCH27682
UniProt: K0JR27
Position
354071..354703
Genome map
AA seq 210 aa AA seqDB search
MTEIDQAGLSVTGEAGSTRRTFDQKRAEAAVRELLLACGEDPDREGLQETPARVARAYRE
LFAGLYTDPDSVLAKTFDESHEELVLVTDIPMFSFCEHHLLPFHGVAHVGYIPNEHGRVT
GLSKLARLVDLYSKRPQVQERLTSQVADALVRRLEPRGVIVVIEAEHLCMGMRGVRKPGS
RTTTSAVRGILRSSASSRAEAIELIRGRTR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagatcgaccaggccggcctctccgtcaccggggaggccggctccacgaggcgg
acgttcgaccagaagcgggccgaggcggcggtgcgcgagctgctgctcgcgtgcggcgag
gacccggaccgcgaagggctccaggagacgccggcgcgggtcgcgcgggcctaccgggag
ctgttcgcgggcctgtacaccgacccggactcggtgctggcgaagaccttcgacgagagc
cacgaggagctcgtcctggtcaccgacatcccgatgttctcgttctgcgagcaccacctg
ctgccgttccacggggtggcgcacgtcgggtacatccccaacgagcacgggcgggtgacc
gggctgtccaagctggcccggctggtcgacctctactccaagcggccccaggtgcaggag
cggctgacctcgcaggtcgccgacgccctggtgcgccggctcgaaccgcgcggcgtgatc
gtcgtgatcgaggccgaacacctgtgcatggggatgcggggtgtccgcaagcccggctcg
cggaccaccacgtccgccgtgcgcgggatcctgcggtcctccgcctcgtcccgggcggag
gccatcgagctcatccgcgggcgcacgcggtga

DBGET integrated database retrieval system