KEGG   Saccharothrix espanaensis: BN6_04430Help
Entry
BN6_04430         CDS       T02404                                 

Definition
Sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sesp  Saccharothrix espanaensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN6_04430
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BN6_04430
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN6_04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(454923..456341)
Genome map
AA seq 472 aa AA seqDB search
MSLHQLAAAVLLPGFHGTTAPDWLLKRVADGLGGVVLFGRNVVDDAQVTALTAALRGVRP
DVVVGIDEEGGDVTRLDAAVGSEVPGNHALGAAGDLGLTRAVAASIGARLARTGVSLNLA
PSADLVLTLDDPVIGVRAFGSDPVAAGEQVAAFVDGMQANGVAACAKHFPGHGASTVDSH
EALPVLPRTEQELRDVELVPFRAAVQAGVRSVMTGHLVVRGWGPLPATLNPRAVQVLREE
LGFTGAIITDGLDMKAVGGDLAQGSVQALVAGVDALCLGGEPLDDAGLQWLIDAIVAAVE
RGELPQARLAEAARRTAALGTPPAAVDGHDPEIGLKAARQALEVTGDLALSGPPVVLDLA
VKASIAVGDEVPWGLGPYLVDLVPGTTVLDTRDAAEVAAAAGGRTVVVVTREAHRFPWAR
DLVRALVTIGLDLVHVETGVPGPDLGTAARVNTHGGSRVCLRAAAERIAAST
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcaccagctcgccgctgccgtgctgctgccgggattccacggcaccacggct
ccggactggttgctcaagcgggtggccgacggcctgggcggtgtggtgctgttcggccgc
aacgtcgtggacgacgcccaggtgacggcgctgacggcggcgttgcgcggggtgcggccg
gacgtcgtggtcggcatcgacgaggagggcggcgacgtcacccggctggacgccgcggtc
gggtccgaggtcccgggcaaccacgcgctgggcgcggcgggcgacctggggctgacccgg
gcggtagcggcgtccatcggcgcgcggctggccaggaccggggtgagcctgaacctggcg
ccctcggccgacctggtgctgaccctggacgacccggtgatcggcgtgcgggccttcggg
tccgacccggtggccgcgggcgagcaggtggccgcgttcgtggacgggatgcaggccaac
ggcgtggccgcgtgcgcgaagcacttccccggccacggtgcgtccactgtggactcgcac
gaggcgttgccggtgctgccgcgcaccgagcaggagctgcgggacgtggagctggtgccg
ttccgggcggccgtgcaggcgggcgtccggtcggtgatgaccgggcacctggtggtgcgg
ggctgggggccgttgcccgcgacgctgaaccccagggccgtgcaggtgctgcgcgaggag
ctcggcttcaccggcgcgatcatcaccgacgggctggacatgaaggccgtgggcggcgac
ctcgcccagggctcggtccaggcgctggtggcgggcgtcgacgcgctgtgcctgggtggc
gagccgctcgacgacgccgggttgcagtggctgatcgacgccatcgtggcggccgtggaa
cgcggtgagctgccgcaggcccggctcgcggaggcggcccgccgcaccgcggccctgggc
acgccgcccgccgcagtcgacggccacgacccggagatcggcctcaaggcggcccggcag
gcgctggaggtgaccggcgacctggcgctgtccggcccgccggtggtgctggacctggcg
gtcaaggcgtccatcgcggtgggcgacgaggtgccgtggggcctgggcccgtacctggtc
gacctggtgcccggcacgaccgtgctggacacccgggacgcggccgaggtcgcggcggcg
gccggcggccggactgtcgtggtcgtgacacgagaggcacatcgcttcccgtgggctcgc
gacctggtccgcgcactggttactattggtctagacctagtccacgtcgagaccggcgtc
ccgggtccggacctgggcaccgctgcccgcgtgaacacccatggcggttcacgggtgtgc
ctgcgagccgcggcagagcgcatcgccgccagcacctga

DBGET integrated database retrieval system