KEGG   Saccharothrix espanaensis: BN6_04430Help
Entry
BN6_04430         CDS       T02404                                 

Definition
Sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sesp  Saccharothrix espanaensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sesp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sesp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(454923..456341)
Genome map
AA seq 472 aa AA seqDB search
MSLHQLAAAVLLPGFHGTTAPDWLLKRVADGLGGVVLFGRNVVDDAQVTALTAALRGVRP
DVVVGIDEEGGDVTRLDAAVGSEVPGNHALGAAGDLGLTRAVAASIGARLARTGVSLNLA
PSADLVLTLDDPVIGVRAFGSDPVAAGEQVAAFVDGMQANGVAACAKHFPGHGASTVDSH
EALPVLPRTEQELRDVELVPFRAAVQAGVRSVMTGHLVVRGWGPLPATLNPRAVQVLREE
LGFTGAIITDGLDMKAVGGDLAQGSVQALVAGVDALCLGGEPLDDAGLQWLIDAIVAAVE
RGELPQARLAEAARRTAALGTPPAAVDGHDPEIGLKAARQALEVTGDLALSGPPVVLDLA
VKASIAVGDEVPWGLGPYLVDLVPGTTVLDTRDAAEVAAAAGGRTVVVVTREAHRFPWAR
DLVRALVTIGLDLVHVETGVPGPDLGTAARVNTHGGSRVCLRAAAERIAAST
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcaccagctcgccgctgccgtgctgctgccgggattccacggcaccacggct
ccggactggttgctcaagcgggtggccgacggcctgggcggtgtggtgctgttcggccgc
aacgtcgtggacgacgcccaggtgacggcgctgacggcggcgttgcgcggggtgcggccg
gacgtcgtggtcggcatcgacgaggagggcggcgacgtcacccggctggacgccgcggtc
gggtccgaggtcccgggcaaccacgcgctgggcgcggcgggcgacctggggctgacccgg
gcggtagcggcgtccatcggcgcgcggctggccaggaccggggtgagcctgaacctggcg
ccctcggccgacctggtgctgaccctggacgacccggtgatcggcgtgcgggccttcggg
tccgacccggtggccgcgggcgagcaggtggccgcgttcgtggacgggatgcaggccaac
ggcgtggccgcgtgcgcgaagcacttccccggccacggtgcgtccactgtggactcgcac
gaggcgttgccggtgctgccgcgcaccgagcaggagctgcgggacgtggagctggtgccg
ttccgggcggccgtgcaggcgggcgtccggtcggtgatgaccgggcacctggtggtgcgg
ggctgggggccgttgcccgcgacgctgaaccccagggccgtgcaggtgctgcgcgaggag
ctcggcttcaccggcgcgatcatcaccgacgggctggacatgaaggccgtgggcggcgac
ctcgcccagggctcggtccaggcgctggtggcgggcgtcgacgcgctgtgcctgggtggc
gagccgctcgacgacgccgggttgcagtggctgatcgacgccatcgtggcggccgtggaa
cgcggtgagctgccgcaggcccggctcgcggaggcggcccgccgcaccgcggccctgggc
acgccgcccgccgcagtcgacggccacgacccggagatcggcctcaaggcggcccggcag
gcgctggaggtgaccggcgacctggcgctgtccggcccgccggtggtgctggacctggcg
gtcaaggcgtccatcgcggtgggcgacgaggtgccgtggggcctgggcccgtacctggtc
gacctggtgcccggcacgaccgtgctggacacccgggacgcggccgaggtcgcggcggcg
gccggcggccggactgtcgtggtcgtgacacgagaggcacatcgcttcccgtgggctcgc
gacctggtccgcgcactggttactattggtctagacctagtccacgtcgagaccggcgtc
ccgggtccggacctgggcaccgctgcccgcgtgaacacccatggcggttcacgggtgtgc
ctgcgagccgcggcagagcgcatcgccgccagcacctga

DBGET integrated database retrieval system