KEGG   Saccharothrix espanaensis: BN6_04820Help
Entry
BN6_04820         CDS       T02404                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sesp  Saccharothrix espanaensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN6_04820
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN6_04820
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN6_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494787..496142
Genome map
AA seq 451 aa AA seqDB search
MILPRPVSFTPGEGDVVWDGSIESRLTLDGPSGAYRLVVGPGVVVEAADEAGLFYARQTL
RQLAGPDSFRAAPISREPVRLPVCVVEDEPRFAWRGVMLDVARHFLPKHDLLRYVDLMAV
HKLNVLHLHLTDDQGWRFECKKFPLLHEVGGWRPSSRYGDRRSGGQTGRPHGGYYTQDDL
REVVAYAAQRHITVVPEIDVPGHSQAAIAAYPELGVTPGGVWTDWGVNPNALKADEATVD
FYRQVFDELLDVFPSEVIGLGGDEAEGGDGRFVRRIAQHLVQRGRRPHGWDEVLDVGPLP
TTTVVASWRGEEAGLTALDRGHDVVMCPEAHVYLDYRQGAGEDEPIPVGTLLTWEDVYAY
EPAAADRVLGAQTNVWTEHLDSPRRVDYAVFPRLCAFAEVVWSTPARDVEEFRARLAGHH
LPRLDALGVEYRPLTGPKPWQTLPGVPGFPR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgattcttcctcgaccggtgtccttcacgcccggcgaaggcgacgtcgtctgggacggc
tcgatcgagagccggctcacgctcgacgggccgtccggcgcgtaccggctggtggtcggg
ccgggcgtggtggtcgaagcggccgacgaggccgggctgttctacgcgcgccagaccctc
aggcagttggcgggaccggattccttccgcgccgcgccgatctcgcgggagcccgtgcgg
ctgccggtgtgcgtggtcgaggacgagccccggttcgcgtggcgcggcgtgatgctcgac
gtggcgcggcacttcctgcccaagcacgacctgctgcggtacgtggacctcatggccgtg
cacaagctgaacgtgctgcacctgcacctcaccgacgaccagggctggcgcttcgagtgc
aagaagttcccgctgctgcacgaggtcggcggctggcgaccgtcctcgcggtacggggac
cggcgcagcggcggccagaccggccggccgcacggcggctactacacgcaggacgacctg
cgcgaggtggtggcgtacgcggcacagcggcacatcaccgtcgtgcccgagatcgacgtg
cccggccacagccaggcggcgatcgcggcctacccggaactcggcgtcacgcccggcggg
gtgtggaccgactggggcgtgaaccccaacgcgctcaaggccgacgaggccacggtggac
ttctaccggcaggtgttcgacgagctgctggacgtgttcccgagcgaggtcatcgggctg
ggcggcgacgaggccgagggcggcgacgggcggttcgtccggcgcatcgcgcagcacctg
gtccagcgcggccgccggccgcacggctgggacgaggtcctggacgtcggtccgctgccc
accacgacggtcgtcgcgtcgtggcggggcgaggaggccgggctcacggcgctggaccgg
ggccacgacgtggtcatgtgccccgaggcgcacgtctacctggactaccgccagggcgcc
ggcgaggacgagcccatcccggtcggcaccctgctgacctgggaggacgtctacgcctac
gagcccgcggcggccgaccgggtgctcggcgcacagacgaacgtgtggaccgagcacctc
gactccccgcggcgcgtcgactacgccgtcttcccccggttgtgcgcgttcgccgaggtg
gtgtggagcaccccggcccgtgacgtcgaggagttccgggccaggctcgccgggcaccac
ctgccgaggctggacgcgctgggcgtcgagtaccgcccgctgaccggtccgaagccgtgg
cagacgctgcccggcgtccccggcttcccccggtga

DBGET integrated database retrieval system