KEGG   Saccharothrix espanaensis: BN6_06770Help
Entry
BN6_06770         CDS       T02404                                 

Definition
Nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sesp  Saccharothrix espanaensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN6_06770
   00052 Galactose metabolism
    BN6_06770
   00500 Starch and sucrose metabolism
    BN6_06770
   00520 Amino sugar and nucleotide sugar metabolism
    BN6_06770
Enzymes [BR:sesp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN6_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
682082..682963
Genome map
AA seq 293 aa AA seqDB search
MSAFQTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPGIELVAAEAAQAGATKLVIVTSPG
KDAVAEYFRPQPELERTLEARGKSDLVEKVRRASTLLHVETAIQDKALGLGHAVGCAEGN
LTGDDEAVAVLLPDDLVLPTGVLTRMSAVRERFGGSVLCAFDIPKEQISAYGVFDVRETD
DDDVKQVVGMVEKPRSEDAPSTFAAAGRYLLDRAVFDALKRITPGSGGELQLTDAIALLI
EEGHPVHVVVHRGGRHDLGNPGGFLKAAVDFALEHPDYGPELGEWLRERLGNS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttccagacagcaatcgtgcccgctgcggggttgggcacgcgcttcctcccc
accaccaaagcggtgcccaaggagctgctgccggtcgtggacaccccggggatcgagctg
gtcgccgccgaggccgcccaggccggtgcgaccaagctcgtgatcgtcacctcaccgggc
aaggacgcggtcgccgagtacttccggccgcagcccgagctggagcggacgctcgaagcg
cgcggcaagagcgacctggtcgagaaggtccggcgcgcgtccaccctgctgcacgtggag
accgcgatccaggacaaggccctgggcctgggccacgcggtcggctgcgcggagggcaac
ctgaccggcgacgacgaggccgtggccgtgctgctgcccgacgacctggtgctgcccacc
ggcgtgctgacccggatgtccgcggtgcgcgagcggttcggcgggagcgtgctctgcgcg
ttcgacatccccaaggagcagatctccgcgtacggcgtgttcgacgtccgcgagaccgac
gacgacgacgtcaagcaggtcgtcggcatggtcgagaagcccaggtccgaggacgcgccg
tcgacgttcgcggcggccggccggtacctgctcgatcgggcggtgttcgacgcgctcaag
cggatcacgcccggctcgggcggcgagctgcagctcaccgacgccatcgcactgctgatc
gaagagggtcacccggtgcacgtcgtggtccaccggggtgggcgacacgacctgggcaat
ccgggaggattcctcaaagctgcggttgacttcgcacttgagcacccggactacgggccc
gagcttggggagtggttgcgggaacgcctcggcaactcctga

DBGET integrated database retrieval system