KEGG   Saccharothrix espanaensis: BN6_07050Help
Entry
BN6_07050         CDS       T02404                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritolkinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sesp  Saccharothrix espanaensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN6_07050 (ispE)
Enzymes [BR:sesp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BN6_07050 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711024..711989
Genome map
AA seq 321 aa AA seqDB search
MLAVVPPPVTVRVPAKVNLHLAVGDPRADGYHDLVTIFQALSLTDEVTVSVADDPGVEVH
GEGADVVPTGPSNLAWRAARVLAEHVGRDPDHPKVRVSIRKAIPVAGGMAGGSADAAATL
VGLASLWRLEIGRDELAGLAAKIGADVPFALYGGTALGTDRGDQIVPVLARHQFHWVLAF
DRRGLSTPEVFGELDRLRADGDPPRVGAAEAVLEGLASGDPRQLALLLGNDLQAAAVSLR
PNLRRTLRAGVDAGALAGMVSGSGPTCAFLCTDADSAVRVAAELAGAGVCRTVRVAQGPV
HGARVIGTEETPRPTPPEVHA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgtagtcccacccccggtcaccgtccgcgtcccggccaaggtcaacctgcac
ctggcggtcggtgacccgcgcgcggacggctaccacgacctggtgacgatcttccaagcg
ctgtccctgaccgacgaggtgacggtctcggtcgccgacgaccccggcgtcgaggtgcac
ggcgagggtgcggacgtggtgcccaccggaccgtcgaacctggcctggcgggcggcgcgg
gtgctggccgagcacgtcggccgcgaccccgaccaccccaaggtccgggtgtcgatccgc
aaggccatcccggtcgcgggcggcatggcgggcggcagcgcggacgcggcggcgaccctg
gtcggcctggcctcgctgtggcggctggagatcggccgggacgagctggcggggctggcc
gccaagatcggcgcggacgtcccgttcgcgctctacggcggcaccgcgctgggcaccgac
cggggcgaccagatcgtgcccgtgctggcccgccaccagttccactgggtgctcgcgttc
gaccggcgcggcctgtccacgcccgaggtgttcggcgagctcgaccggctgcgcgccgac
ggcgacccgccccgggtcggtgcggccgaggccgtgctggaagggctcgcgtcgggcgac
ccccggcagctcgccctgctgctgggcaacgacctccaggccgccgcggtgtcgctgcgg
ccgaacctgcgccgcaccctgcgcgccggggtggacgccggtgcgctggccgggatggtg
tccgggtccggtcccacctgcgcgttcctctgcaccgacgccgactcggcggtccgggtg
gccgccgagctggccggcgcgggggtgtgccgcacggtgcgcgtcgcgcaggggcccgtc
cacggggcgcgggtgatcgggaccgaggagacgcctcggccgacaccgcccgaagtccac
gcttga

DBGET integrated database retrieval system