KEGG   Saccharothrix espanaensis: BN6_07180Help
Entry
BN6_07180         CDS       T02404                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN6_07180
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BN6_07180
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BN6_07180
Lipid biosynthesis proteins [BR:sesp01004]
 Desaturase
  First
   BN6_07180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
725742..726701
Genome map
AA seq 319 aa AA seqDB search
MTSTLESRSTPPGPEDKGPKPMIDGRRGHVEQLGVYVFVVVPFLALIAAVPFAWGWGLGW
VDVALFVAFYYLAGLGVTIGYHRYFTHGSFKANRALKIGLAIAGSMALQGPVIVWVADHR
RHHAFSDREGDPHSPWLFGSGPVALAKGFWHAHMGWLFERDKTNAKRFAPDLLADKDLVW
VDKYFVLWTTISLVAPGVLGGLITMSWAGALSAFFWAGLVRVAFLHHVTWSVNSICHMVG
DRPFAARDRSANVWALAILSFGESWHNLHHADPTCARHGVKRGQIDTSARMIWLFEKFGW
ATDVRWPNQQRLARISAKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccctggagagcaggtccacgccgcccggtcctgaggacaagggacccaag
ccgatgatcgacggtcgtcgcggccacgtggagcagctcggtgtctacgtgttcgtcgtc
gtgccgttcctggcgctgatcgcggcggtcccgttcgcctggggttgggggttgggctgg
gtcgacgtggcgctgttcgtcgcgttctactacctggccggcctgggtgtcacgatcggc
taccaccgctacttcacgcacggctcgttcaaggcgaaccgggcgctcaagatcggcctg
gccatcgcgggcagcatggcgctgcagggcccggtcatcgtctgggtcgccgaccaccgg
cggcaccacgcgttctccgaccgcgagggcgacccgcactcgccgtggctgttcggcagc
ggcccggtcgcgctggccaagggcttctggcacgcccacatgggctggctgttcgagcgc
gacaagaccaacgccaagcgcttcgcgccggacctgctggccgacaaggacctggtctgg
gtcgacaagtacttcgtgctgtggaccacgatcagcctggtcgcgcccggcgtcctgggc
ggcctgatcacgatgtcgtgggccggcgcgctgtccgcgttcttctgggcgggcctggtc
cgggtggcgttcctgcaccacgtgacctggtcggtcaactcgatctgccacatggtcggc
gaccgcccgttcgccgcgcgggaccgctccgcgaacgtctgggcgctggcgatcctgtcg
ttcggcgagtcgtggcacaacctgcaccacgccgacccgacctgcgcgcggcacggcgtc
aagcgcggccagatcgacacctcggcgcggatgatctggctgttcgagaagttcggctgg
gcgaccgacgtgcgctggcccaaccagcagcggctcgcccggatcagcgcgaagaagtga

DBGET integrated database retrieval system