KEGG   Saccharothrix espanaensis: BN6_08580Help
Entry
BN6_08580         CDS       T02404                                 

Gene name
dapE
Definition
Succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sesp  Saccharothrix espanaensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sesp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sesp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
869122..870189
Genome map
AA seq 355 aa AA seqDB search
MADTLHLAADPVELTAELVDVPSVSGAEAELADLVERSLRAQTGLEVIRSGNSVLARTNL
GLPKRVILAGHLDTVPVNDNLPSRLEDGVLHGLGTCDMKGGDAVMLNLAATVDRPRHDLT
FVFYDCEEVEAARNGLGRIERELRSWLDADLAIVCEPSNASVEAGCQGTMRVELRTSGVR
AHTARGWMGVNAIHGVGEALRRLESYSARTVDIDGCVYREGLQAVSISGGVAGNVVPDLC
VLSVNHRFAPDRTPEQAEAHLREVFAGFELTVTDSAAGALPGLGTEAAQELVRAAGGTPV
AKLGWTDVARFAALGMPAVNFGPGDPTLAHTQQENVPVNQIRQCREVLHRFLNED
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacaccttgcacctcgctgccgatcccgtcgagttgaccgccgagctggtggac
gtgcccagcgtctccggtgcggaggccgagctggcggacctggtggagcgctcgttgcgc
gcgcagacggggctggaggtgatccggtctggcaactcggtgctggcgcgcacgaacctg
gggttgcccaagcgggtgatcctggccggccacctggacaccgtcccggtgaacgacaac
ctgccgtcacggctggaggacggcgtgctgcacgggctcggcacgtgcgacatgaagggc
ggtgacgcggtgatgctcaacctcgccgcgaccgtcgaccggccccgccacgacctcacg
ttcgtgttctacgactgcgaggaggtcgaggcggcgcgcaacggcctggggcgcatcgag
cgggagctgcggtcctggctggacgcggacctggcgatcgtgtgcgagccgtcgaacgcc
tcggtcgaggcggggtgccaggggaccatgcgggtcgagttgcggacttccggtgtccgg
gcgcacaccgcgcgggggtggatgggcgtcaacgcgatccacggggtgggcgaggcgttg
cggcggctggagtcgtattccgcgcggaccgtggacatcgacgggtgcgtgtaccgcgag
ggccttcaggccgtgagcatctccggtggggtcgcggggaacgtggtgccggacttgtgc
gtcctgtcggtcaaccaccggttcgcgccggatcggacgccggagcaggccgaggcgcac
ctgcgcgaggtgttcgccgggttcgagctcacggtgaccgactccgccgccggggcgttg
ccggggttgggcacggaggcggcgcaggagctggtgcgggccgccggcgggacgccggtg
gcgaagctcgggtggacggacgtggcgcggttcgcggcgttggggatgccggcggtgaac
ttcgggccgggtgacccgacgctggcccacacgcagcaggagaacgtcccggtgaaccag
atccgacagtgccgggaagtgttgcaccgcttcctcaacgaggactga

DBGET integrated database retrieval system