KEGG   Saccharothrix espanaensis: BN6_11350Help
Entry
BN6_11350         CDS       T02404                                 

Gene name
hexA1
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sesp  Saccharothrix espanaensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sesp00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sesp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199712..1201484
Genome map
AA seq 590 aa AA seqDB search
MKLRARSARALAGLVLVVGTTVVWNAGSAPVAAIAAEPLQSVVPVPASVQAVPGAAHTLN
ATTKIYTTAAAHGVGDHLAGVLRPSTGYPFPVEDTTGTPADGVALLIGGAPSTVGDQGYQ
LTVAAAAITLRANTAAGLFAGVQTLRQLLPGKVESATPQTGPWTVPGATITDHPRFTHRG
AMLDVARHFHPVATVKRYLDQLALYKVNYFHLHLTDDQGWRIVVDSWPKLATHGGSTQVG
GGPGGYYTKAQYQEIVAYAAARHITVIPEVDLPGHTNAALASYAELNCNGVAPGLRTDIA
VGYSSLCVSKDITYKFVEDVIREIAELTPGPYFHIGGDEASATTDQDYQTFMNKVLPLVA
KYGKKPMGWHEFIKTTTDTAAVPQYWGTTTSNAVVQAAAARGAKVLMSPANKAYLDMKYN
PSTPLGLSWAGMIEVQDAYNWNPGTHLSGVPETAVRGVEAPLWTETIVTPAHIDFMAFPR
LAAIAELGWSPWSTHNWDAFKVRLGAQAPRWTARGIEFYRSTQVPWDNGGTTTTTTTTTS
GVPSGSWAPWIGYATDAQVTYNGGTYRCRQPHTSQPGWEPTNVPALWQRV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactccgagcaaggtcggcgcgcgcgctcgccggcctggtgctggtcgtcggcacg
acagtggtgtggaacgcgggctcggccccggtcgccgccatcgcggccgagccactgcag
agcgtcgtcccggtcccggcctccgtgcaggcggtgcccggcgcggcgcacaccctcaac
gccaccaccaagatctacaccaccgcggcggcgcacggcgtcggcgaccacctggccggc
gtgctgcggccgtccaccggttacccgttcccggtcgaggacaccaccggcacccccgcc
gacggcgtcgcgctgctgatcggcggagcgccgtcgaccgtgggcgaccagggctaccag
ctcaccgtcgccgcggccgcgatcaccctgcgcgccaacaccgccgccgggctgttcgcc
ggcgtgcagaccctgcgccagctgctgcccggcaaggtggagagcgccaccccgcagacc
gggccgtggaccgtgcccggcgcgaccatcaccgaccacccccggttcacccaccggggc
gcgatgctcgacgtggcccggcacttccaccccgtcgccacggtgaagcggtacctcgac
cagctggcgctgtacaaggtcaactacttccacctgcacctgaccgacgaccagggctgg
cggatcgtggtcgacagctggccgaagctcgccacccacggcggcagcacgcaggtcggc
ggcgggccgggcgggtactacaccaaggcgcagtaccaggagatcgtcgcctacgcggcg
gcgcggcacatcaccgtgatccccgaggtcgacctgcccggccacaccaacgcggcgctc
gcctcgtacgccgagctgaactgcaacggcgtcgcgcccggcctgcgcaccgacatcgcg
gtcggctacagctcgttgtgcgtgagcaaggacatcacctacaagttcgtcgaggacgtc
atccgggagatcgccgagctcacccccggaccgtacttccacatcggcggcgacgaggcc
agcgccaccaccgaccaggactaccagaccttcatgaacaaggtcctgccgctggtcgcc
aagtacggcaagaagccgatgggctggcacgagttcatcaagaccaccaccgacaccgcg
gccgtgccgcagtactggggcaccacgacgtccaacgccgtcgtgcaggccgccgccgcg
cgcggcgcgaaggtgctgatgtccccggccaacaaggcgtacctggacatgaagtacaac
cccagcacgccgctcggcctgagctgggccgggatgatcgaggtgcaggacgcctacaac
tggaaccccggcacgcacctgagcggggtgcccgaaacggcggtccgcggcgtcgaggct
ccactgtggacggagacgatcgtcaccccggcgcacatcgacttcatggcgttcccgagg
ctcgccgcgatcgccgaactgggctggtcgccgtggtcgacgcacaactgggacgcgttc
aaggtccggctcggcgcgcaggccccgcgctggaccgcgcggggcatcgagttctaccgc
tcgacccaggtcccctgggacaacggggggaccacgacgacgaccaccaccacgacctct
ggtgtgccgtccggttcgtgggcaccatggatcggatacgcgaccgacgcccaggtcacc
tacaacggcggcacgtaccggtgtcgccaaccgcacacctcgcagccgggctgggagccg
accaacgtcccggccctctggcagcgggtctag

DBGET integrated database retrieval system