KEGG   Saccharothrix espanaensis: BN6_11440Help
Entry
BN6_11440         CDS       T02404                                 

Gene name
mtnD
Definition
Acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sesp  Saccharothrix espanaensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BN6_11440 (mtnD)
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BN6_11440 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BN6_11440 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209163..1209726
Genome map
AA seq 187 aa AA seqDB search
MTLLTVWPDTEPDTVLVRTAAPDLIADELKRLGVRYEQWPVLPGVTRENALEVYADQVKR
VTETEGYVLVDAMEMTPSDDPEWLAKAGEARLRFLAEHTHDDDEDRFFARGSGVFYLHVE
GKVHAVLCEAGDLLSVPENTTHWFDMGTRPDYVSIRFFHDDDGWVGNFTGSEIAKSFPTF
DALTAGR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctgaccgtgtggccggacaccgagcccgacaccgtgctggtgcgcacggcg
gccccggacctgatcgccgacgagctcaagcggttgggcgtgcggtacgagcagtggccg
gtgctgcccggggtgacccgggagaacgccctggaggtgtacgccgaccaggtcaagagg
gtcaccgagaccgagggctacgtcctggtcgacgcgatggagatgaccccgtccgacgac
ccggagtggctggcgaaggccggtgaggcgcggctgaggttcctggccgagcacacccac
gacgacgacgaggaccggttcttcgcgcgcggctcgggcgtgttctacctgcacgtcgag
ggcaaggtgcatgccgtgctgtgcgaggccggcgacctgctcagcgtgccggagaacacc
acccactggttcgacatgggcacccgcccggactacgtgtcgatccggttcttccacgac
gacgacggctgggtgggcaacttcaccggcagcgagatcgccaagtccttccccaccttc
gacgccctcaccgcgggtcgctga

DBGET integrated database retrieval system