KEGG   Saccharothrix espanaensis: BN6_11590Help
Entry
BN6_11590         CDS       T02404                                 

Definition
Isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sesp  Saccharothrix espanaensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sesp00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223687..1224256)
Genome map
AA seq 189 aa AA seqDB search
MTRALIVVDVQNDFCEGGSLAVPGGAAVAAAISSHVAAGGYDHVVATRDYHVDPGDHFSA
TPDFVDSWPVHCVAGTAGASFHPEFDVTPVEAVFSKGAYAAAYSGFEGASGGGESLTDWL
RRRGVEQVDVVGIATDHCVRATALDAASAGFATTVLLGLTAGVARATVDTALDRLREAGV
TLEGAPHVG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccagggcgctgatcgtggtggacgtccagaacgacttctgcgagggcggatcgctc
gcggtgccgggcggcgcggcggtggcggcggcgatctcgtcgcacgtcgcggcgggcggc
tacgaccacgtcgtggcgacccgggactaccacgtggacccgggcgaccacttcagtgcg
acgccggacttcgtggactcgtggccggtgcactgcgtggccggcacggccggggcgtcg
ttccacccggagttcgacgtgaccccggtggaggcggtgttctccaagggtgcctacgcg
gcggcgtactcgggcttcgagggcgcgtcgggcggcggcgagtcgttgacggactggttg
cggcggcgcggggtggagcaggtggacgtggtggggatcgccaccgaccactgcgtccgg
gccaccgcgctcgacgccgcgtcggcgggcttcgccaccacggtcctgctcggcctcacg
gcgggtgtcgcgcgggcgaccgtcgacaccgcgctggaccggctgcgcgaggcgggcgtc
accctggagggcgcgccgcacgtcggctga

DBGET integrated database retrieval system