KEGG   Saccharothrix espanaensis: BN6_14410Help
Entry
BN6_14410         CDS       T02404                                 

Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN6_14410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN6_14410
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN6_14410
Enzymes [BR:sesp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN6_14410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1503340..1504602)
Genome map
AA seq 420 aa AA seqDB search
MTAVSVPSATTSFDLGPARALSCRECGHQTPLAPEYACLECFGPLEVAYDFGRVRREDIE
AGPRSIWRYRGLLPVPSNVESHPNTNPGATRLVEADRLAKALGVRKVWVKDDTGNPTHSF
KDRVVGVALAAARELGFKVLACPSTGNLANAVAAAAARAGWQSVVLVPSSLEQAKILMTA
VYGGNLITVDGNYDDVNRLAQELAAEHEDWAFVNVNVRPYYAEGSKTLGYEVAEQLGWRL
PDQIVVPIASGSQLTKVDKAFREFGELGLVDATPYKVFGAQATGCSPVSAAFKSGQDVVT
PVRPDTIARSLAIGAPADGPYVLDAVRRTNGAIEDVTDEEVVEGIRLLARTEGIFAETAG
GVTVATAKKLIETGRLDPDAETVLLITGDGLKTLDALGDRVGPRANVPPSAEAVLNALKD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtcagtgtgccttcggccaccacctccttcgacctcggtccggctcgcgcc
ctgtcgtgccgtgaatgcggtcaccagactccgctggccccggaatacgcctgtctcgag
tgtttcgggccgctggaagtcgcctacgacttcggccgcgtccgccgcgaggacatcgag
gccggcccacggtcgatctggcgctaccgcggcctgctcccggtgccctcgaacgtcgag
tcgcaccccaacaccaaccccggcgccacccgcctggtcgaggccgaccgcctcgccaag
gccttgggcgtgcgcaaggtctgggtgaaggacgacaccggcaaccccacccactcgttc
aaggaccgcgtcgtcggcgtcgccctcgcggccgcccgcgagctgggcttcaaggtcctg
gcctgcccctccaccggcaacctggccaacgccgtcgccgccgccgcggcccgcgccggc
tggcagtcggtcgtgctggtgccctcctccctggagcaggccaagatcctcatgaccgcc
gtctacggcggcaacctgatcaccgtcgacggcaactacgacgacgtgaaccgcctcgcg
caggaactggccgccgagcacgaggactgggcgttcgtcaacgtcaacgtccgcccctac
tacgccgagggctccaagaccctgggctacgaggtggccgagcagctgggctggcggctg
cccgaccagatcgtggtgcccatcgcgtccggctcccagctgaccaaggtggacaaggcc
ttccgcgagttcggcgagctcggcctggtcgacgccaccccgtacaaggtgttcggcgcc
caggccaccggctgctcgccggtgtcggcggcgttcaagtccggtcaggacgtggtgacc
ccggtccgcccggacaccatcgcccgctcgctggcgatcggcgccccggccgacggcccg
tacgtgctggacgcggtccgccgcaccaacggcgcgatcgaggacgtcaccgacgaggaa
gtggtcgagggcatccgcctgctggcgcgcaccgagggcatcttcgccgagaccgccggc
ggcgtgaccgtcgccacggcgaagaagctcatcgagaccggccggctcgacccggacgcc
gagacggtgctgctgatcaccggcgacggcctgaagaccctcgatgccctcggcgaccgc
gtcggtccccgcgccaacgtcccgccctcggccgaggccgtgctgaacgcgctgaaggac
tga

DBGET integrated database retrieval system