KEGG   Saccharothrix espanaensis: BN6_14620Help
Entry
BN6_14620         CDS       T02404                                 

Gene name
pld
Definition
Phospholipase D (EC:3.1.4.4)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sesp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sesp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sesp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519916..1521349)
Genome map
AA seq 477 aa AA seqDB search
MVDRTRTRRTHPRRDALRLGAIAGVVALAPAVPAAASSPAFRHGVASGDPLPDRVVLWTR
VTPTDDATPGSGRGPDVTVDYEIADDAAFRRVVARGCARTGPHRDHTVKLDVAGLRPNRR
YYYRFTYDGTRSPVGRTRTAPSRRADVEALRFGVVSCSNWGVGHFAAYRHLAERDDLDAV
LHLGDYLYEGHDGTTVPLRPAEPPHETVTLADYRQRHAQYQTDPDLQQLHAAYPWIITVD
DHEFADNAWAGGSPSHTEGDEGTWADRKAAALRAYREWMPVRFDGEHVYRRLRYGTLAEI
TMLDLRGYRSRQLEPGQQDTPDRTMTGGVQTNPDQWDGYRHDRDAVLSWPAERNIADTVF
LTGDVHCSWAFEVPGDGYPVRPPLATELVVPSVTSDNIDELTGSPPRTTSLAIEAALLGL
NRHLKWVELDSHGYAVLDVTAARIRLDWYFLADRTRRDSPATLAKSVTVGSGSQRLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaccggacacgcaccagacgaacacaccccagaagggacgcgctgcggctcggc
gcgatcgccggagtcgtggcgctcgctcccgccgtgcccgccgcggcctcctcacccgcc
ttccgccacggggtcgcgtccggcgaccccttacccgaccgcgtcgtcctgtggacccgc
gtcaccccgacagacgacgccacccccggctccgggcgcggcccggacgtcaccgtcgac
tacgagatcgccgacgacgcggcgttcagacgtgtcgtggcacgcggttgcgcacgcacc
ggcccgcaccgcgaccacaccgtcaaactcgacgtggcggggctgcgcccgaaccgccgg
tactactaccgcttcacgtacgacggcacccgatccccggtcggccgcacgcggaccgcg
ccctcccgccgggccgacgtcgaggcgctgcggttcggcgtcgtgtcgtgctcgaactgg
ggtgtcggacacttcgccgcctaccggcacctcgccgaacgcgacgacctggacgccgtg
ctgcacctgggcgactacctgtacgagggccacgacggcaccaccgtgccgctgcggccc
gccgaaccgccccacgagaccgtgaccctggccgactaccggcagcgccacgcgcagtac
cagaccgacccggacctccagcagctgcacgccgcctacccgtggatcatcaccgtcgac
gaccacgagttcgccgacaacgcgtgggccggcggttcccccagccacaccgaaggcgac
gaaggcacgtgggccgaccgcaaggcggcggcactgcgcgcctaccgcgagtggatgccc
gtccggttcgacggcgagcacgtctaccggcggctgcgctacggcacgctcgccgagatc
accatgctggacctgcgcggctaccgcagccggcaactcgaaccgggacagcaggacacc
cccgaccgcaccatgaccggtggcgtccagaccaacccggaccagtgggacggctaccgg
cacgaccgcgacgcggtgctgtcgtggccggccgagcggaacatcgccgacaccgtcttc
ctgaccggtgacgtgcactgctcgtgggcgttcgaggtgccgggcgacggctacccggtg
cgcccgcccctggcgaccgaactggtcgtgccgtcggtgacgtcggacaacatcgacgag
ctgaccggctcgccgccgcgcaccacgtccctggcgatcgaggccgcgctgctgggcctc
aaccgccacctgaagtgggtcgaactggactcgcacggctacgcggtgctcgacgtgacc
gccgcccggatccggctggactggtacttcctggccgaccggacccgccgggactccccc
gcgaccctggccaagtcggtcaccgtcgggtccgggtcgcagcggctgtcctga

DBGET integrated database retrieval system