KEGG   Saccharothrix espanaensis: BN6_15980Help
Entry
BN6_15980         CDS       T02404                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sesp  Saccharothrix espanaensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN6_15980 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN6_15980 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BN6_15980 (sucB)
Enzymes [BR:sesp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN6_15980 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652603..1654432)
Genome map
AA seq 609 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDRVEVDEPLLEVSTDKVDTEIPSPAAGVLQKIV
AQEDETVEVGAELAVIGDGDAAPAQESAPEPQAAPEPEAPAEQAPAQEQAPAQQSAPQQS
GQQESAPQQSGQQESGAAEGTPVTMPALGESVTEGTVTRWLKQVGDPVEVDEPLLEVSTD
KVDTEIPSPVAGTLLEITAGEDETVEVGGQLAVVGSGSPAPAAPKHAQQDPKPAEQAPAQ
SAPAEEAPKPAQQAPAQPAQTQPQPTQAQPAKSEPAKSEPAKSEPAQAEPAASDDANGAP
YVTPLVRKLASENGIDLGSLKGTGVGGRIRKQDVLAAVEAAKAPAPAPAAAAPSAPAQRV
ATAPADTSGKRGTVQKLPRLRQIVAQRTRESLQVSAQLTQVFEVDVTKIARLRNRAKAAF
EQREGTKLTFLPFFAKAAVEALKQHPVLNASIDEEKKEVVYHGAEHLGIAIDTERGLLNA
VIANAGDLNLAGLSHKIGDLAARARSNKLTPDELTGGTFSLTNLGSNGALFDTPIIQQPQ
VGILGVGVVKKRAVVITDENGDDTIAIRSMAYLALTYDHRLVDGADAGRFLTTVKNRLEE
GSFEADLGL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccaaatgcccgcactcggcgaaagcgtcaccgagggcacggtcacc
cgctggttgaagcaggagggtgaccgcgtcgaggtcgacgagccgttgctggaggtgtcc
accgacaaggtcgacaccgagatcccgtcgccggcggcgggtgtgctccagaagatcgtc
gcccaggaggacgagaccgtcgaggtcggcgcggagctcgccgtcatcggcgacggcgac
gcggccccggcccaggagtccgcacccgagccgcaggccgccccggagcccgaggccccg
gccgagcaggccccggcgcaggagcaggcacccgcccagcagtccgcaccccagcagtcg
gggcagcaggaatccgcgccccagcagtccgggcagcaggagtccggtgccgccgaaggc
accccggtgaccatgccggcgctcggcgagagcgtcaccgagggcaccgtgacccgctgg
ctcaagcaggtcggcgacccggtcgaggtcgacgagccgctgctggaggtgtccaccgac
aaggtcgacaccgagatcccgtcgccggtcgccggcaccctgctggagatcaccgcgggc
gaggacgagaccgtcgaggtcggcggccagctcgcggtcgtcggctcgggctcccccgcg
ccggccgccccgaagcacgcgcagcaggacccgaagcccgccgagcaggcaccggcccag
tccgcgcccgccgaggaggcccccaagcccgcgcagcaggccccggcccagcccgcgcag
acccagccgcagccgacgcaggcccagccggccaagtccgagcccgcgaagtccgagccc
gcgaagtccgagcccgcccaggccgagcccgccgcgtcggacgacgccaacggcgcgccg
tacgtgacgccgctggtccgcaagctggcctcggagaacggcatcgacctggggtccctc
aagggcaccggcgtcggcggtcggatccgcaagcaggacgtgctggccgccgtcgaggcc
gccaaggccccggctcccgcgccggccgccgcggcaccctcggccccggcgcagcgggtc
gcgaccgcgcccgcggacaccagcggcaagcgcggcaccgtgcagaagctgccccgcctg
cggcagatcgtggcgcagcggacccgcgagtcgctccaggtgtcggcgcagctcacccag
gtgttcgaggtggacgtcaccaagatcgcccggctgcgcaaccgcgccaaggcggcgttc
gagcagcgcgagggcaccaagctcacgttcctgccgttcttcgcgaaggccgccgtcgaa
gcgctcaagcagcacccggtgctcaacgcgtcgatcgacgaggagaagaaggaggtcgtg
taccacggtgccgagcacctgggtatcgcgatcgacaccgagcgcggcctgctcaacgcc
gtgatcgcgaacgcgggcgacctcaacctggccggactgtcgcacaagatcggcgacctc
gccgcacgggcgcgcagcaacaagctgaccccggacgagctgaccggcggcacgttctcg
ctgaccaacctgggcagcaacggcgcgctgttcgacaccccgatcatccagcagccgcag
gtcggcatcctgggtgtcggcgtggtcaagaagcgcgcggtggtgatcaccgacgagaac
ggtgacgacaccatcgcgatccgctcgatggcctacctggccctcacctacgaccaccgc
ctggtggacggcgcggacgcgggccgcttcctcaccacggtcaagaaccgcctcgaagag
ggctcgttcgaggccgacctcggcctctag

DBGET integrated database retrieval system