KEGG   Saccharothrix espanaensis: BN6_18630Help
Entry
BN6_18630         CDS       T02404                                 

Gene name
hemY
Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00860  Porphyrin and chlorophyll metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN6_18630 (hemY)
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BN6_18630 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BN6_18630 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like FAD_binding_2 Pyr_redox NAD_binding_9 Pyr_redox_2 Trp_halogenase SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: CCH29183
UniProt: K0JYA8
Position
1927970..1929397
Genome map
AA seq 475 aa AA seqDB search
MRALHVAVVGGGISGLVAAHRLRCLLGGRARVTVLEQTSRLGGKLRTGEVGGLAYDVGAE
AFLHRRPEAAELVAEVGLAGRLVHPTGVPATIRAGGRVRPVPAHTMLGVPASVEAVRQVL
SADGLRRVAGEPALPPIELAGADVAVGPLLRERFGPEVGDRLVGPLLGGVYAGRPDALGL
RATMPQLATALDSGVGSLLAAAATTMPAPPQPHGRKPPVFGTLAGGLSVLVARLAELSGA
EVRLGQPVRGLARREQGWRLEIGSASAPAHLDVDGVVLAVPAPAARKLLAEAVPGASKGF
AEVEVASMAVVALALPPGTELPERSGVLLAEGERYADGTPFTAKAFTFSSRKWAHLAGGP
VLVRGSVGRHGEVEALQRDDEDLVAAVRADLAELTGVTAAPLDVVVTRWGGGLPQYGVGH
LDVVRGIEDAVAEAPGLAVAGATLHGVGVPACIATGDAAAARVAAHVLGRVRDAG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctgcacgtcgcggtggtcggtggcggtatctccggcctggtcgccgcgcac
cggctgcgctgcctgctcggcgggcgggcccgggtcaccgtgctggagcagacctcccgg
ctgggcggcaagctgcgcaccggcgaggtcggcgggctggcctacgacgtgggcgcggag
gcgttcctgcaccgccgccccgaagcggccgagctggtcgccgaggtgggcctggccggg
cggctggtgcacccgaccggggtgcccgcgacgatccgggccggcggccgggtgcggccg
gtgcccgcgcacaccatgctcggcgtgcccgcgtcggtcgaggccgtccggcaggtgctc
agcgccgacgggctgcgccgggtggccggcgaacccgcgctgccgccgatcgagctggcc
ggcgcggacgtcgcggtgggcccgctgctgcgcgagcggttcgggcccgaggtcggcgac
cggctggtcgggccgctgctgggcggcgtctacgcgggccgcccggacgcgctgggcctg
cgcgccaccatgccgcagctggccaccgcgctggactccggcgtcgggtcgctgctggcc
gccgccgcgaccaccatgcccgccccgccgcagccgcacggccgcaagccgccggtgttc
ggcaccctggccggtggcctgtcggtgctggtggcccggttggccgagctgtccggggcg
gaggtccggctgggtcagccggtgcgcggcctggcccgccgcgagcagggctggcggctg
gagatcggctcggcctccgcgcccgcgcacctggacgtggacggcgtcgtgctggccgtg
cccgcgccggccgcccgcaagctgctggccgaggcggtgcccggcgcgtcgaaggggttc
gccgaggtggaggtggcgtcgatggccgtggtggcgctcgcgctgccgccgggcacggag
ctgccggagcgctccggcgtgctgctggccgagggcgagcggtacgccgacggcaccccg
ttcaccgccaaggcgttcaccttctccagccgcaagtgggcgcacctggcgggcggcccg
gtgctggtgcgcggcagcgtcggccggcacggcgaggtcgaggcgctgcaacgcgacgac
gaggacctggtggcggcggtccgggccgacctggccgagctgaccggcgtcacggccgcg
ccgctcgacgtcgtggtgacccgctggggcggcggcctgccgcagtacggcgtgggccac
ctcgacgtggtgcgcggcatcgaggacgcggtggccgaggcgcccgggctggccgtcgcc
ggcgcgaccctgcacggcgtgggcgtcccggcgtgcatcgccaccggggacgcggcggcg
gcccgtgtcgccgcacacgtgctcggccgggtacgggacgccgggtga

DBGET integrated database retrieval system