KEGG   Saccharothrix espanaensis: BN6_24640Help
Entry
BN6_24640         CDS       T02404                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sesp  Saccharothrix espanaensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sesp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2604314..2604904
Genome map
AA seq 196 aa AA seqDB search
MISSLRGQVLSIGLDHAVVEVGGVGFAVQATPTTLAVLRRGEEAQLATALVVREDSLTLF
GFADAEARELFGLLQTVSGIGPRLALATLAVLEPDKLRAALAEGNITVLTQVPGIGRKGA
ERLIIELRDKVGQLQTAPAAASGTGLVRTHVAEALLGLGFPAKQAEQAVDAVLAEDGSLG
TSEVLRRALAALGRKR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcctcgctgcgcgggcaggtgctgtccatcggactcgaccacgcggtcgtggag
gtcggcggcgtcggcttcgccgtgcaggccacgcccaccacgctggccgtgctgcgccgc
ggcgaggaggcccagctcgccaccgcgctggtggtccgcgaggactcgctgaccctgttc
gggttcgccgacgccgaggcgcgcgagctgttcggcctgctccagacggtgtccgggatc
ggcccccggctcgccctggccaccctggcggtgctggagccggacaagctgcgcgccgcg
ctcgccgagggcaacatcaccgtgctcacccaggtgcccggcatcggccgcaagggcgcg
gagcggctgatcatcgagctgcgggacaaggtcggccaactgcagaccgcgcccgccgcc
gcgtccggcaccggcctggtgcgcacccacgtcgccgaggcgctgctcgggctcgggttc
ccggccaagcaggccgagcaggccgtggacgcggtgctcgccgaggacggctcgctgggc
acctccgaggtgctgcgccgggcgctggccgcgttgggccgcaagcgatga

DBGET integrated database retrieval system