KEGG   Saccharothrix espanaensis: BN6_25260Help
Entry
BN6_25260         CDS       T02404                                 

Gene name
rfbC1
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sesp  Saccharothrix espanaensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sesp00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sesp00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2668491..2669093
Genome map
AA seq 200 aa AA seqDB search
MTGVAAPKQGMDMTVTPTGIEGVFVVQPEWFEDERGFFFESYSKRRWEQHGLHLDFVQDN
HSRSSAGVLRGFHFQNGLAPQHRLVRCTVGAIYDVVVDIRVGSPTFGQWFGIELSAANRT
QLLMGPEFAHGFAVLSEIAEVQYKTTGFHNPAAEGLLAWNDPDVGVRWPVENPTLSAKDS
ANPSLATYLANPAFHYGESA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactggggtagcggccccgaagcagggcatggacatgacggtcacgccgaccgggatc
gaaggcgtgttcgtcgtccagccggagtggttcgaggacgagcgcgggttcttcttcgag
tcctacagcaagcggcgctgggaacagcacggcctgcacctggacttcgtgcaggacaac
cactcccgctcgtcggcgggtgtgttgcgcgggttccacttccagaacggcctggccccg
cagcaccgcctggtccgctgcacggtcggcgcgatctacgacgtggtggtggacatcagg
gtcggctcgccgaccttcgggcagtggttcggcatcgagctgtccgccgccaaccgcacc
cagctgctgatgggcccggagttcgcgcacggcttcgcggtgctctccgagatcgccgag
gtgcagtacaagacgaccggcttccacaacccggcggccgagggcctgctggcgtggaac
gacccggacgtgggcgtgcggtggcccgtcgagaacccgacgctgtcggcgaaggacagc
gccaaccccagcctggcgacctacctggcgaacccggcgttccactacggagaatcagcg
tga

DBGET integrated database retrieval system