KEGG   Saccharothrix espanaensis: BN6_26020Help
Entry
BN6_26020         CDS       T02404                                 

Gene name
xylA
Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sesp  Saccharothrix espanaensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sesp00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sesp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2759573..2760529
Genome map
AA seq 318 aa AA seqDB search
MDRSSFGLWTVGRHTGLVVPMVTTNLFTHPVFKDGGFTSNDRSVRRFALRKVLRNLELAA
ELGASTVVLWGGREGSEVDAGKDVRAALDRYREALDIVVRYSEDQGCGLRFAVEPKPNEP
RGDILLPTIGHALAFISTLEHHELVGVNPEVGHEQMAGLNVVHGVAQALWQGKLFHLDLN
GQKGPRYDQDLVFGHGDLLSAFFLVDLVEHGGYDGPRHFDYKPLRTEDLDGVWVSAAANM
RTYRLLRERAVVFRADPEVQEALRHSGVYELGESTLAPGESVAEFVVQDEDASGAAERGY
GFVRLSQLALEHLVGARG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggacaggtccagcttcggcctgtggacggtcggccggcacaccgggctggtggtgccg
atggtgaccaccaacctgttcacccacccggtgttcaaggacggcgggttcacctcgaac
gaccggtcggtgcggcggttcgcgctgcgcaaggtgctgcgcaacctggagctcgcggcg
gagctgggtgcctcgaccgtggtgctgtggggtggccgggaggggtcggaggtggacgcg
ggcaaggacgtccgggcggcgctggaccggtaccgggaggcgctggacatcgtcgtgcgg
tactccgaggaccagggttgcgggctgcggttcgcggtggagcccaagccgaacgagccg
cgcggcgacatcctgctgccgaccatcgggcacgcgctggcgttcatctcgacgctggag
caccacgagctggtcggcgtgaaccccgaggtcgggcacgagcagatggcgggcctcaac
gtcgtgcacggcgtcgcgcaggcgctgtggcagggaaagctgttccacctcgacctcaac
gggcagaaggggccgcgctacgaccaggacctcgtgttcgggcatggcgacctgttgtcc
gccttcttcctggtcgacctggtggagcacggcgggtacgacggaccccggcacttcgac
tacaagccgttgcgcaccgaggaccttgatggcgtgtgggtgagcgcggcggccaacatg
cgcacgtatcggctgttgcgggagcgggcggtggtgttccgggccgatcccgaggtgcag
gaggcgttgcggcacagcggggtgtatgagctgggcgagtcgaccttggctcccggtgag
tctgttgcggagtttgtggtccaggatgaggatgcttccggtgcggcggagcggggttac
gggttcgtccggttgtcgcagttggcgttggagcacttggtgggggctcgcggatga

DBGET integrated database retrieval system