KEGG   Saccharothrix espanaensis: BN6_31270Help
Entry
BN6_31270         CDS       T02404                                 

Definition
Permease, MFS-type
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sesp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3330162..3331547
Genome map
AA seq 461 aa AA seqDB search
MTSGLPTTVGALRAAGYPPRSVKAELRENLVEALRAKRDPWPGIVGFDRTVLPQLERAIL
AGHDLVLLGERGQGKTRLLRSLVGLLDEWTPVIDGAELGEHPLLPITPESRRRAAELGDD
LPVAWRHRDERFAEKLATPDTSVGDLVGDVDPVKVAQGRSLGDPETIHYGLVPRAHRGII
AVNELPDLAERIQVSLLNVMEERDIQIRGYTLRLPLDVLVVATANPEDYTNRGRIITPLK
DRFGAEIRTHYPLEVAAEVALVRQESELVAEVGDHLLEAVARFVRHLRESPAIDQRSGVS
ARFAVAAAETVAAAALRRSALIGEHPPIARPVDLYSVPDVLRGKLEFEAGEEGREHEVLT
HLLRRAVADTARSAFAGLNLRSLAEVVSDGHPVATGEQVPAAEVLAALPELPVLHDVAQR
VGAGPADPPGRIASAVELALESLYLTRQLAKDSDEDRTVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgacctctggacttcccacgaccgtgggcgcgctgcgtgccgccgggtacccgccgcgc
agcgtcaaggccgagctgcgggagaacctggtcgaggcgttgcgcgcgaagcgcgacccg
tggccgggcatcgtcgggttcgaccggaccgtgctgccgcagctggagcgggccatcctg
gccggccacgacctggtgctgctcggcgagcgcggccagggcaagacccggctgctgcgc
tcgctggtcggcctgctcgacgagtggacgccggtcatcgacggcgcggagctgggcgag
cacccgctgctgccgatcacgccggagtcccggcggcgggccgcggagctgggcgacgac
ctgccggtggcgtggcggcaccgcgacgagcggttcgccgagaagctggccacgccggac
accagcgtcggcgacctggtcggcgacgtcgacccggtgaaggtggcgcaggggcgcagc
ctcggcgacccggagacgatccactacggcctggtgccgcgcgcgcaccggggcatcatc
gcggtcaacgagctgcccgacctggccgagcggatccaggtgtcgctgctcaacgtgatg
gaggagcgcgacatccagatccgcggctacacgctgcggctgccgctggacgtgctggtg
gtggcgaccgcgaaccccgaggactacacgaaccggggccggatcatcaccccgctcaag
gaccggttcggcgccgagatccgcacccactacccgctggaggtggccgccgaggtggcg
ctggtccggcaggagtcggagctggtggcggaggtgggcgaccacctgctggaagccgtg
gcgcggttcgtgcggcacctgcgcgagtcgccggcgatcgaccagcgctcgggcgtgtcg
gcgcggttcgcggtggccgcggcggagacggtggccgcggcggcgttgcggcgcagcgcg
ctgatcggcgagcacccgccgatcgcccgcccggtcgacctctactcggtgccggacgtg
ctgcgcggcaagctggagttcgaggcgggggaggaggggcgtgagcacgaggtgctgacg
cacctgctgcgccgggccgtcgcggacaccgcgcgctcggcgttcgccgggctgaacctg
cgctcgctggccgaggtggtctccgacggccacccggtggcgaccggcgagcaggtgccg
gcggccgaggtgctcgccgcgctgccggagctgccggtgctgcacgacgtggcgcagcgg
gtcggcgcgggcccggcggacccgccggggcggatcgcgtcggccgtggagctggcgctg
gagtcgctctacctgacccgtcagctggccaaggacagcgacgaggaccggacggtctac
gggtga

DBGET integrated database retrieval system