KEGG   Saccharothrix espanaensis: BN6_31760Help
Entry
BN6_31760         CDS       T02404                                 

Gene name
celE
Definition
Endoglucanase E-5 (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sesp  Saccharothrix espanaensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_31760 (celE)
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BN6_31760 (celE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3381820..3382884
Genome map
AA seq 354 aa AA seqDB search
MARLRIALALAATLALPGVLVGAAQAAPTPGLSTQAAAALPAGSPAAVNGQLKVCGVKLC
NKYGKPIQLRGMSTHGIQWYSQCVKTASLDALAGDWKADVLRISMYIQEDGYETNPRKFT
DMVHGYIEEATKRGLYALVDWHQLDPGDPNYNTSRAKTFFKEIAQRHKDKTNIIYDIANE
PNNVSWAKVKSYAEQVIPVIRAEDSDSLVLVGTNGWSTFGHSDGKDPQDVVKNKVSASNV
MYTFHFYAGDHGSDYLAVLSKLADQVPVFVTEFGTQKASGDGSNNFTQSQKYIDLMNAKK
ISWVNWNFSDDERSGAVFKPGTCSGSSFTGTSKLKPAGVWIRDRIRTADDFPTS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcacggctccggatcgcactggccctggcggccacgctcgcactacccggcgtcctg
gtgggcgcggcacaagcggcacccacgcccgggttgtcgacccaggcggcagccgccctg
cccgcgggctcgcccgccgcggtcaacggccagctcaaggtgtgcggcgtcaagctgtgc
aacaagtacggcaagccgatccagctccgcggcatgagcacgcacggcatccagtggtac
tcgcagtgcgtcaagaccgcctcgctcgacgcgctggcgggcgactggaaggccgacgtc
ctccggatctccatgtacatccaggaagacgggtacgagaccaacccgcgcaagttcacc
gacatggtgcacgggtacatcgaggaggccaccaagcgcggcctgtacgccctggtcgac
tggcaccagctcgaccccggcgacccgaactacaacacctcgcgcgccaagacgttcttc
aaggagatcgcccagcggcacaaggacaagaccaacatcatctacgacatcgccaacgag
ccgaacaacgtgtcgtgggcgaaggtcaagtcctacgccgagcaggtcatcccggtcatc
cgcgccgaggactccgacagcctggtgctggtcggcacgaacggctggtccaccttcggg
cactccgacggcaaggacccgcaggacgtggtcaagaacaaggtgtccgcgtcgaacgtc
atgtacacgttccacttctacgccggcgaccacggcagcgactacctcgccgtgctgtcg
aagctcgccgaccaggtgccggtgttcgtcaccgagttcggcacccagaaggcgtccggc
gacggctcgaacaacttcacccagtcgcagaagtacatcgacctgatgaacgcgaagaag
atcagctgggtcaactggaacttctccgacgacgagcgctccggcgcggtgttcaagccc
ggcacctgctccggctcctcgttcaccggcaccagcaagctcaagcccgccggcgtgtgg
atccgcgaccgcatccgcaccgccgacgacttcccgacgagctga

DBGET integrated database retrieval system