KEGG   Saccharothrix espanaensis: BN6_33640Help
Entry
BN6_33640         CDS       T02404                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BN6_33640
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BN6_33640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N NAD_binding_8 Pyr_redox_2 FAD_binding_3 FAD_binding_2 DAO
Motif
Other DBs
NCBI-ProteinID: CCH30666
UniProt: K0JX84
Position
3635431..3636978
Genome map
AA seq 515 aa AA seqDB search
MGNRRTTTTPTGRDRVDREEQHGAVIIGSGVGGSVTAFRLAEAGVDNLVLERGRRWPITP
AADTFPRWPSPDKRLLWVGGRPPVPLLSQVPWLGSVAEEVAAKLLPRSTGLLDVLPHRNL
TMVCGAGVGGGTLVYGGMLPQPRAEAFQRAFPPELDYEEFDRTYYPRARDRLGGTEFPDD
LLARSTYRSAEIWRDALVDAGLPLERVTNTYDFDVVRAELNGTARASVTIGQYLFTGCNS
GAKLSIDRTYLARAEATGRTEVRPLHEVTKIGQHPNGRYHLVVDHLDIRGTVLERVGITC
DRLVLAAGGVHTPRMLVTAKATGQLPRLNEFIGGQWGTNGDQMYALKVKAMPAGGPHGGP
PAFLTRSGDGMALVTHGGAAGLGKSWMLCPGMGIPDRFGRWTWSTITSRPRLEWARGSDA
STRQATRDLMRQVARNIDGGATVHDPFATHPLVLHPLGGVVLNKATDAYGRLHGYDGLYC
LDSALMPGCTAAVNPVLTIAAVVERCLDHIVDDFT
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaaccgacgcacgaccaccacaccgacgggccgcgaccgcgtggaccgcgaagag
cagcacggagccgtcatcatcggctcaggggtgggcggcagcgtgaccgcgttccggctc
gcggaagcgggcgtggacaacctggtgctggagcgcggccgccggtggccgatcactccg
gcggcggacaccttcccgcggtggccttccccggacaagcgactgctctgggtgggcggc
cgaccgccggtaccgctgctctcccaagttccctggctcgggtccgtcgccgaggaggtc
gccgcgaaactcctcccgcgatccaccggactgctggacgtcctaccgcaccggaacctc
accatggtctgcggagccggtgtcggcggcggcacgctggtctacggcgggatgttgccg
cagccacgggccgaagcgttccagcgggccttcccaccggagctcgactacgaggagttc
gaccggacctactacccgcgcgctcgcgatcgccttggcggcaccgagttccccgacgac
ctgctcgcccgctccacctaccgctcggccgagatctggcgcgatgccctggtcgacgcg
ggactccccctggaacgagtgaccaacacttacgacttcgacgtcgtccgcgccgagctg
aacggcaccgcgcgagcctcggtgaccatcgggcaatacctgttcaccgggtgcaacagc
ggcgcgaagctgagcatcgaccgcacctacttggcgcgcgcggaggcgaccggccggacg
gaggtccggccgctgcacgaggtcacgaagatcggtcagcaccccaacggccgctaccac
ctggttgtcgaccacctcgacatccgcggcacggtgctggagagggtgggaatcacctgt
gaccgcctcgtgctggccgccgggggcgttcacacgccccggatgctggtcaccgccaag
gcgaccgggcagttgcccaggttgaacgagttcatcggtggccagtggggcacgaacggc
gaccagatgtacgccctgaaggtcaaggccatgcccgcgggcggcccgcacggcggacca
ccggccttcctcacccgctccggcgacggcatggccctggtgacccacggtggcgccgca
ggactcgggaagtcgtggatgctctgcccggggatgggcattcccgacaggttcgggcgg
tggacgtggtccacgatcacctccaggccgcgactggagtgggcgcggggcagcgacgcg
agcacccggcaagccaccagggacctcatgcgccaagtggcacggaacatcgacggcggt
gccaccgtgcacgacccgttcgccacacaccccctcgtcctgcaccctctgggcggagtc
gtcctgaacaaggccaccgacgcctacggacgtctgcacggctacgacgggctctactgc
ctcgattccgccctgatgccgggatgcaccgccgcggtcaacccggtgctgaccatcgca
gccgtggtggagcgatgcctcgaccacatcgtggacgacttcacatag

DBGET integrated database retrieval system