KEGG   Saccharothrix espanaensis: BN6_33640Help
Entry
BN6_33640         CDS       T02404                                 

Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sesp  Saccharothrix espanaensis
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BN6_33640
Enzymes [BR:sesp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BN6_33640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3635431..3636978
Genome map
AA seq 515 aa AA seqDB search
MGNRRTTTTPTGRDRVDREEQHGAVIIGSGVGGSVTAFRLAEAGVDNLVLERGRRWPITP
AADTFPRWPSPDKRLLWVGGRPPVPLLSQVPWLGSVAEEVAAKLLPRSTGLLDVLPHRNL
TMVCGAGVGGGTLVYGGMLPQPRAEAFQRAFPPELDYEEFDRTYYPRARDRLGGTEFPDD
LLARSTYRSAEIWRDALVDAGLPLERVTNTYDFDVVRAELNGTARASVTIGQYLFTGCNS
GAKLSIDRTYLARAEATGRTEVRPLHEVTKIGQHPNGRYHLVVDHLDIRGTVLERVGITC
DRLVLAAGGVHTPRMLVTAKATGQLPRLNEFIGGQWGTNGDQMYALKVKAMPAGGPHGGP
PAFLTRSGDGMALVTHGGAAGLGKSWMLCPGMGIPDRFGRWTWSTITSRPRLEWARGSDA
STRQATRDLMRQVARNIDGGATVHDPFATHPLVLHPLGGVVLNKATDAYGRLHGYDGLYC
LDSALMPGCTAAVNPVLTIAAVVERCLDHIVDDFT
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaaccgacgcacgaccaccacaccgacgggccgcgaccgcgtggaccgcgaagag
cagcacggagccgtcatcatcggctcaggggtgggcggcagcgtgaccgcgttccggctc
gcggaagcgggcgtggacaacctggtgctggagcgcggccgccggtggccgatcactccg
gcggcggacaccttcccgcggtggccttccccggacaagcgactgctctgggtgggcggc
cgaccgccggtaccgctgctctcccaagttccctggctcgggtccgtcgccgaggaggtc
gccgcgaaactcctcccgcgatccaccggactgctggacgtcctaccgcaccggaacctc
accatggtctgcggagccggtgtcggcggcggcacgctggtctacggcgggatgttgccg
cagccacgggccgaagcgttccagcgggccttcccaccggagctcgactacgaggagttc
gaccggacctactacccgcgcgctcgcgatcgccttggcggcaccgagttccccgacgac
ctgctcgcccgctccacctaccgctcggccgagatctggcgcgatgccctggtcgacgcg
ggactccccctggaacgagtgaccaacacttacgacttcgacgtcgtccgcgccgagctg
aacggcaccgcgcgagcctcggtgaccatcgggcaatacctgttcaccgggtgcaacagc
ggcgcgaagctgagcatcgaccgcacctacttggcgcgcgcggaggcgaccggccggacg
gaggtccggccgctgcacgaggtcacgaagatcggtcagcaccccaacggccgctaccac
ctggttgtcgaccacctcgacatccgcggcacggtgctggagagggtgggaatcacctgt
gaccgcctcgtgctggccgccgggggcgttcacacgccccggatgctggtcaccgccaag
gcgaccgggcagttgcccaggttgaacgagttcatcggtggccagtggggcacgaacggc
gaccagatgtacgccctgaaggtcaaggccatgcccgcgggcggcccgcacggcggacca
ccggccttcctcacccgctccggcgacggcatggccctggtgacccacggtggcgccgca
ggactcgggaagtcgtggatgctctgcccggggatgggcattcccgacaggttcgggcgg
tggacgtggtccacgatcacctccaggccgcgactggagtgggcgcggggcagcgacgcg
agcacccggcaagccaccagggacctcatgcgccaagtggcacggaacatcgacggcggt
gccaccgtgcacgacccgttcgccacacaccccctcgtcctgcaccctctgggcggagtc
gtcctgaacaaggccaccgacgcctacggacgtctgcacggctacgacgggctctactgc
ctcgattccgccctgatgccgggatgcaccgccgcggtcaacccggtgctgaccatcgca
gccgtggtggagcgatgcctcgaccacatcgtggacgacttcacatag

DBGET integrated database retrieval system