KEGG   Saccharothrix espanaensis: BN6_45250Help
Entry
BN6_45250         CDS       T02404                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN6_45250
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN6_45250
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BN6_45250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4941209..4942030
Genome map
AA seq 273 aa AA seqDB search
MIDLVVSQGRVADRAARMIEGAARTARALEDRYGVKGEFIGEPAPAVVDDWTQSLPQAQD
TLVGLRRAVEASFRAGNVPVMVANTCSASLATLPVVAREHPDAVVLYIDAHGDFNTPQTT
DSGYLGGMVLSAACGLWDSGHGSGLRPERAVLVGTRDVDAAERELLDRAGVRVIPPEEAS
AANVLAAVGDARVWVHIDWDVLDPAYLPADYVVPDGMSPAQIRAIFAAIPPERLVGVEVA
EFNAPLDDQAAAEGVATILDMLAPVFEARAGAR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcttgttgtgtcccagggccgggtggccgaccgggcggcgcggatgatcgag
ggcgcggcgcgcaccgcgcgggccctggaggaccgctacggcgtcaagggcgagttcatc
ggggagcccgcgccggcggtcgtggacgactggacccagagcctgccccaggcgcaggac
acgctggtcgggctgcggcgggcggtggaggccagcttccgggccgggaacgtgccggtg
atggtcgccaacacctgctcggcgagcctggccacgctgccggtcgtggcccgggagcac
ccggacgccgtggtgctctacatcgacgcgcacggcgacttcaacaccccgcagaccacg
gactccggctacctgggcggcatggtgctgtcggccgcgtgcgggctctgggacagcggg
cacggttccgggctgcggcccgagcgggccgtgctggtcgggacccgcgacgtcgacgcc
gccgagcgcgagctgctggaccgggccggggtccgggtcatcccgcccgaggaggcgtcc
gcggccaacgtcctggcggccgtcggcgacgcccgggtgtgggtgcacatcgactgggac
gtgctggacccggcgtacctgcccgccgactacgtcgtgccggacgggatgtcgcccgcc
cagatccgggcgatcttcgcggccatcccgccggagcggctggtcggcgtcgaggtggcg
gagttcaacgcgccgctggacgaccaggccgccgccgagggggtcgccaccatcctggac
atgctcgcgcccgtcttcgaggcgcgggcgggcgcccggtga

DBGET integrated database retrieval system