KEGG   Saccharothrix espanaensis: BN6_45250Help
Entry
BN6_45250         CDS       T02404                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00220  Arginine biosynthesis
sesp00330  Arginine and proline metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01130  Biosynthesis of antibiotics
sesp01230  Biosynthesis of amino acids
Module
sesp_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BN6_45250
   00330 Arginine and proline metabolism
    BN6_45250
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BN6_45250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CCH31805
UniProt: K0JVA9
Position
4941209..4942030
Genome map
AA seq 273 aa AA seqDB search
MIDLVVSQGRVADRAARMIEGAARTARALEDRYGVKGEFIGEPAPAVVDDWTQSLPQAQD
TLVGLRRAVEASFRAGNVPVMVANTCSASLATLPVVAREHPDAVVLYIDAHGDFNTPQTT
DSGYLGGMVLSAACGLWDSGHGSGLRPERAVLVGTRDVDAAERELLDRAGVRVIPPEEAS
AANVLAAVGDARVWVHIDWDVLDPAYLPADYVVPDGMSPAQIRAIFAAIPPERLVGVEVA
EFNAPLDDQAAAEGVATILDMLAPVFEARAGAR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcttgttgtgtcccagggccgggtggccgaccgggcggcgcggatgatcgag
ggcgcggcgcgcaccgcgcgggccctggaggaccgctacggcgtcaagggcgagttcatc
ggggagcccgcgccggcggtcgtggacgactggacccagagcctgccccaggcgcaggac
acgctggtcgggctgcggcgggcggtggaggccagcttccgggccgggaacgtgccggtg
atggtcgccaacacctgctcggcgagcctggccacgctgccggtcgtggcccgggagcac
ccggacgccgtggtgctctacatcgacgcgcacggcgacttcaacaccccgcagaccacg
gactccggctacctgggcggcatggtgctgtcggccgcgtgcgggctctgggacagcggg
cacggttccgggctgcggcccgagcgggccgtgctggtcgggacccgcgacgtcgacgcc
gccgagcgcgagctgctggaccgggccggggtccgggtcatcccgcccgaggaggcgtcc
gcggccaacgtcctggcggccgtcggcgacgcccgggtgtgggtgcacatcgactgggac
gtgctggacccggcgtacctgcccgccgactacgtcgtgccggacgggatgtcgcccgcc
cagatccgggcgatcttcgcggccatcccgccggagcggctggtcggcgtcgaggtggcg
gagttcaacgcgccgctggacgaccaggccgccgccgagggggtcgccaccatcctggac
atgctcgcgcccgtcttcgaggcgcgggcgggcgcccggtga

DBGET integrated database retrieval system