KEGG   Saccharothrix espanaensis: BN6_58230Help
Entry
BN6_58230         CDS       T02404                                 

Definition
Delta-9 acyl-phospholipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sesp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sesp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6502163..6503113
Genome map
AA seq 316 aa AA seqDB search
MSTRIASDLSPAAPQPMVAGEKTTTEMFLVKLFAVVPALALAAAVPLAWGWGLGWVDLGL
AAFFYTLTCLGVTIGFHRYFTHGAFKATRGLRIALAVTGSMAMQGPIIGWVADHRRHHAY
ADREGDPHSPWLFGTSARALAKGFWHAHLGWLFQREQTNAARFTPDLLADADIQRVNRWF
PALTVVTLLAPALAGGLITWSWWGAATGFFWAGLVRVAVLHHVTWSVNSICHLIGDRPFT
ARDKSANFWPLAILSMGESWHNSHHADPTCARHGVRRGQVDVSARLIRVFEKLGWATGVR
WPRPERLARNLKTTAP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgagaatcgcatccgacctttccccagccgcgccgcagcccatggtggccggc
gagaagacgacgaccgagatgttcctggtcaagttgttcgccgtggtgccggcgctggcg
ctcgccgcggcggtcccgctggcgtggggctggggcctcggctgggtcgacctcggcctg
gccgcgttcttctacacgctgacctgcctcggggtgacgatcgggttccaccgctacttc
acgcacggcgcgttcaaagccacccgcgggctgcggatcgcgctcgcggtgaccggcagc
atggccatgcagggcccgatcatcggctgggtcgccgaccaccgccggcaccacgcctac
gccgaccgcgagggcgacccgcactccccgtggctgttcggcacctcggcccgcgcgctg
gccaaggggttctggcacgcccacctgggctggctgttccagcgggagcagaccaacgcc
gcccgcttcacgcccgacctgctcgccgacgccgacatccagcgcgtcaaccgctggttc
cccgcgctgacggtcgtcacgctgctcgcgcccgccctcgccggcgggctgatcacgtgg
agctggtggggcgcggcgaccgggttcttctgggccggcctggtgcgcgtcgccgtgctg
caccacgtcacgtggtcggtgaactcgatctgccacctgatcggcgaccggcccttcacc
gcacgcgacaagtccgcgaacttctggccgctggcgatcctgtcgatgggcgagtcctgg
cacaactcccaccacgccgacccgacctgcgcccggcacggcgtgcgccgcggccaggtc
gacgtctccgcgcggctgatccgggtgttcgagaagctcggctgggccaccggggtccgc
tggccgcgcccggaacgactggcccgcaacctcaagaccaccgccccctga

DBGET integrated database retrieval system