KEGG   Saccharothrix espanaensis: BN6_60560Help
Entry
BN6_60560         CDS       T02404                                 

Definition
Branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sesp  Saccharothrix espanaensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN6_60560
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN6_60560
   00020 Citrate cycle (TCA cycle)
    BN6_60560
   00620 Pyruvate metabolism
    BN6_60560
Enzymes [BR:sesp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN6_60560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6767789..6769087)
Genome map
AA seq 432 aa AA seqDB search
MPDFRLPDLGEGLTEGEIVTWLVAVGDQVSIDQPVVEVETAKAVVEVPCPFEGVVRARFG
EPGEKLAVGSVLLSVGLAAGEEPTPAPSAETGSGNVLIGYGTTDSPRRRRANRRGPGRGA
PPQTTPAVPTQPAPARTASAQPVAVGPAQVVESGPVRPSGVAPAVISPLVRRMARENGLA
LDTIAGSGPGGVIRRVDVERELAARSSAPAAGRRIPLKGLRGVVAAKLATSRREIPEATV
WVDVDATDFLTARAALPGVSLLALLARFTVLGLTKFPELNSRVEGDEIAVLDEIHLGFAA
QTDRGLVVPVVRDAHTLTTSGLAAAITDLATSARDGKIAPAALTGGTFTVNNYGVFGVDG
SAAIINHPEAAILGIGRIIDRPWVVDGQLAVRKVTQLTLAFDHRVCDGGTAGGFLRFVAD
CVQSPITAMADL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgacttccggctgcccgacctgggcgaggggctgaccgagggcgagatcgtcacc
tggctggtggcggtcggcgaccaggtgtcgatcgaccagcccgtggtcgaggtcgagacg
gcgaaggccgtggtcgaggtgccgtgcccgttcgagggcgtggtgcgggcccggttcggc
gagccgggcgagaagctcgcggtcggctcggtgctgctgtcggtggggctcgccgcgggg
gaggagccgacgcccgcgccgtccgccgagacgggttcgggcaacgtgctgatcggctac
ggcaccaccgactcgccccgccgccgccgcgccaaccgtcgcggtcccggtcgcggcgca
ccgccccagaccacccccgccgtcccgacccagcccgctccggctcgcaccgcttcggca
cagcccgtcgcggtgggtccggcgcaggtggtcgagagcgggccggtgcgcccgtcgggg
gtggctccggcggtcatctcgccgctggtgcggcggatggcgcgggagaacgggctggcg
ctggacaccatcgccggcagcggccccggtggcgtgatccgccgggtggacgtcgaacgg
gaactggccgcgcggtcctccgctcccgcggccggccggcggatcccgctcaaggggctg
cgcggggtggtggcggcgaagctggccacgtcccggcgcgagatccccgaggcgaccgtc
tgggtggacgtcgacgcgacggacttcctgaccgcccgcgccgcgctgccgggcgtgtcg
ctgctcgcgctgctggcccggttcaccgtgctgggcctgacgaagttccccgagctgaac
tcccgggtcgagggcgacgagatcgccgtgctggacgagatccacctggggttcgccgcg
cagaccgaccgggggctggtggtgcccgtggtccgcgacgcgcacacgctcaccacgtcc
ggcctggccgccgctatcaccgacctggcgacgtcggcccgggacgggaagatcgccccg
gccgcgctgaccggcgggacgttcacggtcaacaactacggggtgttcggcgtcgacggg
tcggccgcgatcatcaaccaccccgaggcggcgatcctcggcatcggccggatcatcgac
cggccgtgggtggtcgacgggcagctggcggtccgcaaggtcacccagctcacgctcgcc
ttcgaccaccgggtgtgcgacggcggcacggcgggcgggttcctcaggttcgtggccgac
tgcgtgcagtcgccgatcacggcgatggccgacctctga

DBGET integrated database retrieval system