KEGG   Saccharothrix espanaensis: BN6_61840Help
Entry
BN6_61840         CDS       T02404                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sesp  Saccharothrix espanaensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_61840
Enzymes [BR:sesp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BN6_61840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6909304..6911223)
Genome map
AA seq 639 aa AA seqDB search
MTTVTPPGFRAPGATKLSHVDDELAALAELHGVATHYEDSGQRRVEVDPDVVVAVLAQLD
VDASTPEAVRRALTVPRPEPGTLVLRAGDVLPGPGVLVLEDGGELALPAEPPLGYHRLGG
RTVVVAPRALDPVPKVWGWMLQLYAMRSDESWGMGDFADLATIARRSADELGAGVLLVNP
VQAVAPVVPVERSPYSPSSRRFANPLYLRVEDTTAYRDADAATRAAVDALRPDNDTELID
YDAVWTAKKAALELLWPLVEHPDPEGDLRDFARFCALAEVHGPDWRQWPAQQRDPAGATA
DPERVRFHAWLQDLCERQLADAREAAGSMPVGIVHDLPVGVHPGGADTWAIRDAFAPDVR
VGAPPDAFSQLGQDWNLPPWRPDRLAEQGYEPFRAVLRNVLRHGDGIRIDHVAGLWRLWW
IPPGEPAGRGTYVHYDADAMLAVLTLEAHRAGAVVVGEDLGTVEPKVTESLHEHGMLSSA
VLWFQRDYDRPGHPLIPPGEWTTSAMASISTHDLPTVAGFLDAEHVRLRADLGQFAGDPD
GEFRSAERERAELVALLEQEGVAADDLVTAFHALLAKSPSLLCLTSPQDALGETRQPNLP
GTVDEYPNWRIPLPVRLADLFTDTRVRRVAAAFVAGRGR
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggtgaccccgcctggcttccgggcaccgggtgcgacgaagctgtcccacgtg
gacgacgagctggccgcactggccgaactgcacggggtggctacccactacgaggattcc
ggacagcgccgggtggaggtcgaccccgacgtcgtggtggccgtgctggcccaactggac
gtggacgcgtcgaccccggaggcggtgcgccgggcgctgaccgtgccccggcccgagccg
gggaccctggtgctccgggccggtgacgtgctgcccggtcccggtgtgctggtgctggag
gacggcggcgagctggcgctgcccgccgagccgccgctgggctaccaccggctgggcggg
cggacggtggtggtcgcgccgcgcgcgctggacccggtgcccaaggtctggggctggatg
ctccagctctacgccatgcgctcggacgagtcgtggggcatgggcgacttcgccgacctc
gccacgatcgcccggcgcagtgccgacgagctgggcgcgggcgtgctgctggtcaacccg
gtgcaggcggtcgcgccggtcgtcccggtcgagcgctcgccgtactcgccgtccagccgc
cggttcgccaacccgctctacctccgggtcgaggacaccaccgcgtaccgggacgccgac
gcggcgacccgcgcggccgtcgacgcgctgcgccccgacaacgacaccgagctgatcgac
tacgacgccgtgtggacggccaagaaggccgcgctggagctgctctggccgctggtcgag
caccccgaccccgagggcgacctgcgggacttcgcgcggttctgcgcgctcgccgaggtc
cacggcccggactggcggcagtggccggcacagcagcgcgacccggccggcgcgaccgcc
gacccggagcgggtgcggttccacgcctggttgcaggacctgtgcgagcgccagctcgcg
gacgcccgggaggccgccgggtcgatgccggtcggcatcgtgcacgacctgccggtgggc
gtgcaccccggcggggcggacacgtgggcgatccgcgacgcgttcgcgcccgacgtgcgg
gtgggcgcgccgccggacgcgttcagccagctcggccaggactggaacctgccgccgtgg
cggccggaccggctcgccgagcagggctacgagccgttccgcgcggtgctgcgcaacgtg
ctgcggcacggcgacggcatccggatcgaccacgtcgcgggcctgtggcggctgtggtgg
atcccgccgggcgagcccgccggtcgcggcacgtacgtgcactacgacgccgacgcgatg
ctggccgtgctgaccttggaggcgcaccgggcgggcgcggtcgtcgtgggggaggacctg
ggcacggtcgagccgaaggtcaccgagagcctgcacgagcacggcatgctcagctcggcc
gtgctgtggttccagcgcgactacgaccggcccggccacccgctgatcccgccgggggag
tggaccacctcggcgatggccagcatctccacccacgacctgccgacggtggccggtttc
ctcgacgccgaacacgttcggctgcgggccgatctggggcagtttgcgggcgacccggac
ggggaattccggagtgcggagcgggagcgcgcggaactggtcgcgctcctggagcaggaa
ggggtggcggccgatgacctggttaccgctttccacgccctgctggcgaagtccccgtcc
ctcctgtgcctgacatcgccccaggacgcgctgggtgagacccgccagccgaacctgccc
ggcaccgtcgacgagtacccgaactggcggatcccgctgccggtccggctggccgacctg
ttcaccgacacccgtgtgcggcgggtggcggccgcgttcgtggcagggcgcggccggtga

DBGET integrated database retrieval system