KEGG   Saccharothrix espanaensis: BN6_71220Help
Entry
BN6_71220         CDS       T02404                                 

Gene name
aceB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00620  Pyruvate metabolism
sesp00630  Glyoxylate and dicarboxylate metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01120  Microbial metabolism in diverse environments
sesp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN6_71220 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN6_71220 (aceB)
Enzymes [BR:sesp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BN6_71220 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CCH34357
UniProt: K0K9X7
Position
complement(7883214..7884743)
Genome map
AA seq 509 aa AA seqDB search
MTGIRVLGGDVERGDEILTPDALEFVAGLHRAFAATRDELLARRSERGRLGFAEETRHVR
EGDWRVAEAPAPLRDRRVEITGPTERKMTVNALNSGAKVWLADLEDANTPHWHNVVSGQV
NLYDAARGTVEHHSPEGRHYTLKDGERPTIVVRPRGWHLPERHIEVDGVPAVGALVDFGL
HFFHNAALGRPYYYLPKMESHLEARLWNDVFTAAQATLGVPHGTIRATVLIETIPAAFEM
EEILYELRDHASGLNAGRWDYLFSIIKYFRDQGAQYVLPDRNSVTMTAPFMRAYTELLVR
TCHKRGAFAMGGMAAFIPNRRDPEVTAQALAKVRDDKSREAGDGFDGSWVAHPDLVPVCR
ELFDARLGDRPNQLDVLRDDVEVTAEQLLDFASAGGGVTRAGVESAVDVGVRYLVSWLSG
NGAAAIHNLMEDAATAEISRSQLWQWVHNGVAMDDGTPVTAELVRAVLRDVRGRLDGEHL
DLAVELFEQVALADDFVDFLTLPAYERIG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtatccgcgtgctcgggggcgacgtcgagcgtggggacgagatcctcacgccg
gacgccctggagttcgtcgccggcctccaccgcgcgttcgccgccacccgggacgagctg
ctcgcccgccggtccgagcgcggtcggctcgggttcgccgaggagaccaggcacgtccgt
gagggggactggcgggtcgccgaggcgccggcaccgctgcgggaccgccgggtggagatc
accggacccaccgagcgcaagatgaccgtcaacgccctcaactccggcgcgaaggtgtgg
ctggccgacctggaggacgcgaacacgccgcactggcacaacgtcgtctccggtcaggtc
aacctctacgacgccgcccgcggcacggtcgagcaccactcgcccgagggcaggcactac
accctcaaggacggcgagcgccccaccatcgtggtccggccgcgcggctggcacctgccc
gagcggcacatcgaggtcgacggcgtgccggcggtcggcgcgctcgtggacttcggcctg
cacttcttccacaacgccgcgctcggccggccgtactactacctgccgaagatggagagc
cacctcgaagcccggctgtggaacgacgtgttcaccgccgcgcaggccacgttgggcgtc
ccgcacggcacgatccgcgccaccgtgctgatcgagaccatcccggccgcgttcgagatg
gaggagatcctctacgagctgcgcgaccacgcgtccggcctcaacgcgggccgctgggac
tacctgttcagcatcatcaagtacttccgcgaccagggcgcgcagtacgtgctgccggac
cgcaacagcgtgacgatgaccgcgccgttcatgcgcgcctacaccgagctgctggtccgc
acgtgccacaagcgcggggcgttcgccatgggcggcatggccgcgttcatcccgaaccgc
cgcgaccccgaggtgaccgcgcaggcgctcgccaaggtccgcgacgacaagtcccgggag
gccggtgacggcttcgacggcagctgggtggcccaccccgacctggtcccggtgtgccgg
gagctcttcgacgcccggctgggcgaccggcccaaccagctcgacgtgctgcgcgacgac
gtggaggtcaccgccgagcagctgttggacttcgcgtccgcgggcggcggcgtgacgcgg
gccggcgtggagagcgctgtggacgtcggcgtgcgctacctggtgtcgtggctgagcggc
aacggcgcggcggcgatccacaacctgatggaggacgcggcgaccgccgagatctcccgt
tcccagctgtggcagtgggtgcacaacggcgtggcgatggacgacggcacgccggtcacc
gcggagctggtccgcgcggtgctgcgggacgtgcggggcaggctcgacggcgagcacctc
gacctggccgtggagctgttcgagcaggtcgccctggccgacgacttcgtggacttcctg
accctgccggcctacgagcggatcggctga

DBGET integrated database retrieval system