KEGG   Saccharothrix espanaensis: BN6_71220Help
Entry
BN6_71220         CDS       T02404                                 

Gene name
aceB
Definition
Malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sesp  Saccharothrix espanaensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN6_71220 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN6_71220 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN6_71220 (aceB)
Enzymes [BR:sesp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BN6_71220 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7883214..7884743)
Genome map
AA seq 509 aa AA seqDB search
MTGIRVLGGDVERGDEILTPDALEFVAGLHRAFAATRDELLARRSERGRLGFAEETRHVR
EGDWRVAEAPAPLRDRRVEITGPTERKMTVNALNSGAKVWLADLEDANTPHWHNVVSGQV
NLYDAARGTVEHHSPEGRHYTLKDGERPTIVVRPRGWHLPERHIEVDGVPAVGALVDFGL
HFFHNAALGRPYYYLPKMESHLEARLWNDVFTAAQATLGVPHGTIRATVLIETIPAAFEM
EEILYELRDHASGLNAGRWDYLFSIIKYFRDQGAQYVLPDRNSVTMTAPFMRAYTELLVR
TCHKRGAFAMGGMAAFIPNRRDPEVTAQALAKVRDDKSREAGDGFDGSWVAHPDLVPVCR
ELFDARLGDRPNQLDVLRDDVEVTAEQLLDFASAGGGVTRAGVESAVDVGVRYLVSWLSG
NGAAAIHNLMEDAATAEISRSQLWQWVHNGVAMDDGTPVTAELVRAVLRDVRGRLDGEHL
DLAVELFEQVALADDFVDFLTLPAYERIG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtatccgcgtgctcgggggcgacgtcgagcgtggggacgagatcctcacgccg
gacgccctggagttcgtcgccggcctccaccgcgcgttcgccgccacccgggacgagctg
ctcgcccgccggtccgagcgcggtcggctcgggttcgccgaggagaccaggcacgtccgt
gagggggactggcgggtcgccgaggcgccggcaccgctgcgggaccgccgggtggagatc
accggacccaccgagcgcaagatgaccgtcaacgccctcaactccggcgcgaaggtgtgg
ctggccgacctggaggacgcgaacacgccgcactggcacaacgtcgtctccggtcaggtc
aacctctacgacgccgcccgcggcacggtcgagcaccactcgcccgagggcaggcactac
accctcaaggacggcgagcgccccaccatcgtggtccggccgcgcggctggcacctgccc
gagcggcacatcgaggtcgacggcgtgccggcggtcggcgcgctcgtggacttcggcctg
cacttcttccacaacgccgcgctcggccggccgtactactacctgccgaagatggagagc
cacctcgaagcccggctgtggaacgacgtgttcaccgccgcgcaggccacgttgggcgtc
ccgcacggcacgatccgcgccaccgtgctgatcgagaccatcccggccgcgttcgagatg
gaggagatcctctacgagctgcgcgaccacgcgtccggcctcaacgcgggccgctgggac
tacctgttcagcatcatcaagtacttccgcgaccagggcgcgcagtacgtgctgccggac
cgcaacagcgtgacgatgaccgcgccgttcatgcgcgcctacaccgagctgctggtccgc
acgtgccacaagcgcggggcgttcgccatgggcggcatggccgcgttcatcccgaaccgc
cgcgaccccgaggtgaccgcgcaggcgctcgccaaggtccgcgacgacaagtcccgggag
gccggtgacggcttcgacggcagctgggtggcccaccccgacctggtcccggtgtgccgg
gagctcttcgacgcccggctgggcgaccggcccaaccagctcgacgtgctgcgcgacgac
gtggaggtcaccgccgagcagctgttggacttcgcgtccgcgggcggcggcgtgacgcgg
gccggcgtggagagcgctgtggacgtcggcgtgcgctacctggtgtcgtggctgagcggc
aacggcgcggcggcgatccacaacctgatggaggacgcggcgaccgccgagatctcccgt
tcccagctgtggcagtgggtgcacaacggcgtggcgatggacgacggcacgccggtcacc
gcggagctggtccgcgcggtgctgcgggacgtgcggggcaggctcgacggcgagcacctc
gacctggccgtggagctgttcgagcaggtcgccctggccgacgacttcgtggacttcctg
accctgccggcctacgagcggatcggctga

DBGET integrated database retrieval system