KEGG   Saccharothrix espanaensis: BN6_72580Help
Entry
BN6_72580         CDS       T02404                                 

Definition
Glycoside hydrolase family 57
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sesp  Saccharothrix espanaensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_72580
Enzymes [BR:sesp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN6_72580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8027082..8028560
Genome map
AA seq 492 aa AA seqDB search
MTEGTFCLVLHSHLPWLAHHGAWPVGEEWLYQAWAHSYLPVVDLLERFAGEGREDVLTLG
VTPVLAAQLDDPYCLRGVHDWLGDWQLRAHSAAPRLPELSAREHRASRWALEKFETRWRH
GFSPILKSLVDSRTVELLGGPAAHPFQPLLDPGLRAFSLRTGLADTRLRLGSAPEGIWAP
ECAYAPGMEEGYAAAGVRRFLVDGPSLHGDTAAARPVGSSDVLCFGRDLEVSYRVWSPKV
GYPGDPAYRDFHTYDHPSGLKPSRVTGVRVEPGDKAPYSPQDAAVVVRRDAADFVDVVVR
RLRSLRERHGKPSLVVAAYDTELYGHWWHEGPAWLEAVLRALPEAGVRVTTLRGAVEAGH
VGAPVEIPPSSWGAGKDWHVWNGPQVADVVDLNAGVQRELLALDLAGRTRDPVADQAVRE
ALLALSSDWAFMVTKDSAADYARYRAKVHADRFAELAALLRPGGGRGRGRARAAELRALD
GPFGHLDARGLG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggggaccttctgcctggtgctgcacagccacctgccgtggctggcgcaccac
ggggcctggccggtcggcgaggagtggctctaccaggcgtgggcgcactcgtacctgccg
gtcgtggacctgctggagcggttcgccggcgaaggccgcgaggacgtgctgaccctcggc
gtcacgccggtgctggccgcgcagctcgacgacccgtactgcctgcgcggcgtgcacgac
tggctgggcgactggcagttgcgcgcgcacagcgcggcaccccggctgccggagctctcg
gcgcgcgagcaccgggcgtcgcggtgggcgctggagaagttcgaaacccggtggcggcac
ggtttctcccccatcctgaagtcccttgtggacagtcggacggtggagctgctgggcgga
ccggcggcgcacccgttccagccgctgctcgacccggggctgcgggcgttctcgctgcgc
accgggctggccgacacccggctgcggctcgggtccgcgcccgagggcatctgggccccc
gagtgcgcgtacgcgccgggcatggaggaggggtacgcggcggcgggcgtgcggcggttc
ctggtcgacgggccgtcgctgcacggcgacacggccgccgcgcgtccggtggggtcctcg
gacgtgctgtgcttcggacgcgacctggaggtgtcctaccgggtgtggtcgccgaaggtc
ggctaccccggcgacccggcctaccgcgacttccacacctacgaccaccccagcgggctc
aagccgtcccgggtgaccggcgtgcgggtcgagcccggggacaaggccccgtactcgccg
caggacgccgccgtcgtggtgcggcgggacgcggcggacttcgtggacgtcgtggtgcgg
cggctgcggtcgctgcgcgagcggcacgggaagccgtcgctggtcgtcgccgcgtacgac
accgagctgtacgggcactggtggcacgagggcccggcgtggctggaggccgtgctgcgg
gcgctgcccgaggccggcgtgcgggtgacgacgctgcgcggcgcggtggaggcgggccac
gtcggcgcgcccgtggagatcccgccgtcgtcgtggggcgcgggcaaggactggcacgtc
tggaacgggccgcaggtcgccgacgtcgtggacctcaacgcgggcgtccagcgcgaactg
ctcgcgctcgacctcgccggccgcacccgcgacccggtcgccgaccaggccgtgcgggag
gcgctgctggcgctgtccagcgactgggccttcatggtcaccaaggactcggccgccgac
tacgcccgctaccgcgcgaaggtgcacgcggaccggttcgccgaactcgccgcgctgctg
cgccccggtggcgggcgcggtcgtgggcgcgcgcgggcggccgaactccgggccctggac
gggccgttcggccacctcgacgcgcgcgggctcggctga

DBGET integrated database retrieval system