KEGG   Saccharothrix espanaensis: BN6_72610Help
Entry
BN6_72610         CDS       T02404                                 

Gene name
gtuS4-14
Definition
Glycosyltransferase, family 4
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
sesp  Saccharothrix espanaensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_72610 (gtuS4-14)
Enzymes [BR:sesp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     BN6_72610 (gtuS4-14)
Glycosyltransferases [BR:sesp01003]
 Polysaccharide
  Storage polysaccharide
   BN6_72610 (gtuS4-14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8028850..8030097
Genome map
AA seq 415 aa AA seqDB search
MRVLMLSWEYPPVVVGGLGRHVHAVATELARQGHDVVVLCRQPTGSDAVTHPTSDSPVEG
VRLVRVAEDPAHLVFERDLVAWTLAMGHAMTRAGLALLRGWRPEVVHAHDWLVTHAAIAL
AEAAGVPLVATVHATEAGRHSGWLSQTLNQQVHSVEWWLANRADSLITCSAAMRTEVAHL
FEVDPAGITVLHNGIEPRRWRVRPAGVAAAREEFAADGPLLLFFGRLEWEKGVQDLIAAL
PRIRRAHRGTRVVVAGGGTHRDWLVEQARKHRVLRSVRFVGHLPDRTLAAVLAAADAVVL
PSRYEPFGIVALEAAAAGTPLVASTAGGLGEVVLDGVTGLSFAPGDVDGLARAVRSVLAD
RPAAVRRAKAAKARLGTDFDWARIAADTAGVYRAAAAREHGPLGRPKIATGNAFL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgatgttgtcgtgggagtacccgccggtcgtagtgggcgggctgggtcgg
cacgtgcacgccgtggcgaccgaactggcccggcaggggcacgacgtcgtcgtgctgtgc
cgtcagcccaccgggtccgacgccgtcacgcacccgacgtcggactcgccggtggagggc
gtccggctggtccgggtcgccgaggacccggcgcacctggtgttcgagcgcgacctggtg
gcgtggacgctggccatgggccacgcgatgacccgcgcgggcctggcgctgctgcgcggg
tggcggccggaggtcgtgcacgcgcacgactggctggtcacccacgccgcgatagccctc
gccgaggccgccggcgtgccgctggtggccaccgtgcacgccaccgaggccggccggcac
agcgggtggctgtcccagacgctcaaccagcaggtgcactcggtggagtggtggctggcc
aaccgggccgactcgctgatcacctgctccgcggcgatgcggaccgaggtggcccacctg
ttcgaggtcgacccggccgggatcaccgtgctgcacaacgggatcgagccccggcggtgg
cgggtgcggccggccggggtggcggcggcgcgcgaagagttcgccgccgacggcccgctg
ctgctgttcttcgggcggctggagtgggagaagggcgtccaggacctgatcgcggcgctg
ccccggatccgccgggcgcaccggggcacccgggtggtggtggcgggcggcggcacgcac
cgcgactggctggtggagcaggcccgcaagcaccgggtgctgcggtcggtgcggttcgtc
gggcacctgccggaccgcacgctcgcggccgtgctggcggcggccgacgccgtcgtgctg
cccagccggtacgagccgttcgggatcgtggcgctggaggcggcggccgccgggacgccg
ctggtcgcgtccaccgcgggcgggttgggcgaggtcgtgctggacggcgtgaccgggctg
tcgttcgcgccgggtgacgtggacgggctggcgcgggccgtgcgctcggtgctggccgac
cggcccgccgccgtgcgccgggcgaaggccgcgaaagcccggctgggcaccgatttcgac
tgggcccggatcgccgcggacaccgccggcgtctaccgggcggcggccgcccgggagcac
gggccgctcggccggcccaagatcgccaccggcaacgccttcctgtga

DBGET integrated database retrieval system