KEGG   Saccharothrix espanaensis: BN6_72800Help
Entry
BN6_72800         CDS       T02404                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00500  Starch and sucrose metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN6_72800 (glgB)
Enzymes [BR:sesp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BN6_72800 (glgB)
Exosome [BR:sesp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN6_72800 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM Y_Y_Y DUF3459
Motif
Other DBs
NCBI-ProteinID: CCH34512
UniProt: K0KAF7
Position
8053865..8056012
Genome map
AA seq 715 aa AA seqDB search
MTEDVDRLLSGSHHDPHSVLGVHHLPSGEVVARALRPGASAVSVLAGDKRFELDRVADGL
FSGELPEHPGDYRLEVDYGDSTVEVDDPYRWLPTVGELDLHLIGEGRHERLWDVLGARVR
AYDTPAGPVTGVSFAVWAPTARGVRVCGDFDGWDGRAHPLRSLGSSGVWEVFIPGIPAGT
RYKFRILGRDGGWHEKADPMAFATEVPPQTASVVTESTYTWGDAEWEARRDATEWINAPM
SAYEVHLGSWRPGLGYRELAEELAAYVTAAGFTHVELMPVAEHPFGGSWGYQVTSYYAPT
SRFGSPDDFRHFVDVLHAHGIGVIMDWVPAHFPKDSWALARFDGTALYEHADPRRGEHPD
WGTLVFDFGRNEVRNFLVANALYWIEEFHIDGLRVDAVASMLYLDYSREEGQWLPNQYGG
RENLDAVRFLQELNATVYKRHPGVVMVAEESTAWPGVTRPTHLGGLGFGFKWNMGWMHDT
LHYLSREPVHRSFHHNEITFSLVYAWSENFVLPLSHDEVVHGKGSLWQRMPGDDWNKAAG
LRSLLAFMWAHPGKQLLFMGGEFGQQGEWSESRSLDWHLLESPLHAGIHALVGDLNGVYK
QSPALYSADARPEGFEWIDANDSAGNVLSFLRVGADGSVLACVANFAGSPHHDYRVGLPS
TGRWREVVNTDSVGYGGSGVGNLGGVEAVAQPWHGRPASAVLQLPPAGVLWLIPE
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggacgtcgaccggctgctttcggggtcgcaccacgacccgcactcggtgctc
ggcgtgcaccacctgccgtccggcgaggtggtggcgcgggcgttgcggcccggcgcgtcc
gcggtgtccgtgctggccggcgacaagcgcttcgagctggaccgggtggccgacgggctg
ttctccggcgagctgcccgagcacccgggcgactaccggctggaggtcgactacggcgac
tcgaccgtcgaggtcgacgacccgtaccggtggctgcccacggtcggcgagctggacctg
cacctgatcggcgagggccggcacgaacggctgtgggacgtgctcggcgcgcgcgtccgg
gcgtacgacacgccggccggcccggtcaccggcgtgtcgttcgcggtctgggcgccgacg
gcccgcggcgtgcgggtgtgcggcgacttcgacggctgggacggccgcgcgcacccgctg
cgctcgctgggctcgtcgggcgtctgggaggtgttcatccccggcatcccggcgggcacc
cggtacaagttccggatcctgggccgcgacggcggctggcacgagaaggccgacccgatg
gcgttcgccaccgaggtcccgccgcagaccgcgtccgtggtcaccgagtcgacctacacg
tggggcgacgccgagtgggaggcgcgccgcgacgccaccgagtggatcaacgcgccgatg
agcgcttacgaggtccatctgggttcctggcgtccgggtttgggctatcgagagctggcc
gaggagctggccgcgtacgtcacggcggccgggttcacgcacgtcgagctgatgccggtg
gccgagcacccgttcggcgggtcgtggggctaccaggtcacgtcgtactacgcgcccacg
tcccggttcggctcaccggacgacttccggcacttcgtggacgtgctgcacgcccacggc
atcggcgtgatcatggactgggtgccggcgcacttccccaaggactcctgggcgctggcc
cggttcgacggcaccgcgctgtacgagcacgcggacccgcgccggggcgagcacccggac
tggggcaccctggtgttcgacttcgggcgcaacgaggtgcgcaacttcctggtggccaac
gcgctgtactggatcgaggagttccacatcgacggcctgcgggtcgacgcggtggcctcg
atgctgtacctggactactcgcgcgaagagggccagtggctgcccaaccagtacggcggg
cgggagaacctggacgcggtgcggttcctccaggagctcaacgcgacggtctacaagcgg
caccccggcgtggtgatggtggccgaggagtcgacggcgtggcccggcgtcacccggccg
acccacctgggcggcctcgggttcgggttcaagtggaacatgggctggatgcacgacacg
ctgcactacctgtcgcgcgagccggtgcaccggtcgttccaccacaacgagatcacgttc
tcgctggtgtacgcgtggagcgagaacttcgtgctgccgctctcgcacgacgaggtggtg
cacggcaagggctcgctgtggcagcggatgcccggcgacgactggaacaaggcggcgggc
ctgcggtcgctgctggcgttcatgtgggcgcacccgggcaagcagctgctgttcatgggc
ggcgagttcggccagcagggcgagtggtcggagtcgcggtcgctggactggcacctgctg
gagtcgcccctgcacgcgggcatccacgcgctggtgggcgacctgaacggggtgtacaag
cagagcccggcgctctacagcgcggacgcccggcccgagggcttcgagtggatcgacgcg
aacgactcggcgggcaacgtgctgagcttcctgcgcgtcggcgcggacggctcggtgctg
gcgtgcgtggcgaacttcgccggctcgccgcaccacgactaccgggtcggcctgccctcg
accggccgctggcgcgaggtggtcaacaccgactcggtcggctacggcggttccggggtc
ggcaacctcggcggcgtcgaggcggtggcgcagccgtggcacggccggccggcgtcggcg
gtgctgcaactgccgccggccggcgtgctctggctcatccccgagtga

DBGET integrated database retrieval system