KEGG   Saccharothrix espanaensis: BN6_74510Help
Entry
BN6_74510         CDS       T02404                                 

Definition
Helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sesp  Saccharothrix espanaensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sesp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8236182..8238353)
Genome map
AA seq 723 aa AA seqDB search
MAEAVLEAVLERITFANEETGYTVARVDTGRGADLVTVVGALLGAQPGESIRMRGRWGSH
PQYGKQFHVDDYTTVLPATIQGIRRYLGSGLIKGIGPVLADRIVTHFGVDALDVIEQTPQ
RLVEVPKLGPKRTKLIAAAWEEQKAIKEVMVFLQGVGVSTSLAVRIFKQYADKSIDVVRT
EPYRLATDVWGIGFRTADTIAKAVGIPHDSPQRIKAGLQFTLSEATGGGDCFLPENQLIG
EAIKILQVDAGLVIDCLAELVAEEGVVREVMPDGEPAVYLIPFHRAEISLAGQLLRLLRT
GEERLPAFEGVDWDRAFGWLGASLEDKQRDAVRLALTRKVAVLTGGPGCGKSFTVRSIVK
LAMAKRAKVVLAAPTGRAAKRLAELTGHEARTVHRLLELRPGGDAAFDRDRPLDADLVVV
DEASMLDLLLANKLVKAVPPGAHLLLVGDVDQLPSVGAGEVLRDVLAADSPVPNVRLTHI
FRQAQQSGVVTNAHRINSGDYPLVQGLADFFLFPAEEAEDAAALTVDVVARRIPRKFGLD
PRKDIQVLAPMHRGLAGAGALNVVLQEALTPAVKDLPERRFGGRVFRVGDKVTQIRNNYD
KGVNGVFNGTLGVVTSIDVVEQKLTVKTDEDEDVDYEFGELDELTHAYAMTIHRSQGSEY
PCVVIPITTSAWMMLQRNLLYTAVTRAKKLVVLVGSRKAIGQAVRTVGAGRRHTALDYRL
SQG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaggcggtcctggaagcggtgctggagcggatcacgttcgccaacgaggagacc
ggctacacggtcgcccgcgtcgacaccgggcggggtgcggacctggtcaccgtggtcggc
gcgctgctaggcgcgcagcccggcgagtcgatccggatgcgcggccggtgggggtcgcac
ccgcagtacggcaagcagttccacgtggacgactacacgaccgtgctgcccgcgaccatc
cagggcatccgccgctacctggggtcgggcctgatcaagggcatcggcccggtgctcgcc
gaccggatcgtcacgcacttcggcgtggacgcgctcgacgtcatcgagcagaccccgcag
cggctggtcgaggtgcccaagctcgggcccaagcggacgaagctgatcgccgccgcgtgg
gaggagcagaaggccatcaaggaggtcatggtcttcctccagggcgtcggcgtctcgacg
tcgctggcggtgcggatcttcaagcagtacgccgacaagtcgatcgacgtcgtgcgcacc
gagccgtaccggctggcgaccgacgtgtggggcatcggcttccggaccgccgacaccatc
gccaaggcggtcggcatcccgcacgacagcccgcagcggatcaaggccggcctgcagttc
accctgtccgaggcgaccggcggcggcgactgcttcctgccggagaaccagctcatcggc
gaggccatcaagatcctccaggtcgacgccgggctggtcatcgactgcctggcggagctg
gtcgcggaggagggggtggtgcgggaggtgatgcccgacggcgagcccgccgtctacctg
atcccgttccaccgcgcggagatctcactggcggggcagctcctgcggctgttgcggacc
ggcgaggagcggctgcccgcgttcgagggcgtcgactgggaccgggcgttcgggtggctg
ggcgcgtcgctggaggacaagcagcgcgacgccgtgcggttggcgctgaccaggaaggtc
gccgtgctgaccggcgggccaggctgcggcaagagcttcacggtccggtcgatcgtgaag
ctggcgatggccaagcgggccaaggtcgtgctcgccgcgccgaccggccgggcggccaag
cggttggcggagctgaccggccacgaggcgcggaccgtgcaccggctgctggagctcagg
cccggcggcgacgcggcgttcgaccgcgaccgcccgttggacgcggacctggtcgtggtg
gacgaagcgtcgatgctggacctgttgctggccaacaagttggtcaaggccgtgccgccc
ggagcgcacctgctgctggtgggtgacgtcgaccagctgccgtcggtgggggcgggggag
gtgctgcgggacgtgctggcggccgacagccccgtgccgaacgtgcggctgacgcacatc
ttccggcaggcgcagcagtccggcgtggtgaccaacgcccaccggatcaactccggcgac
tacccgctcgtgcagggcctggctgacttcttcctgttcccggcggaggaggcggaggac
gccgccgcgctgacggtcgacgtggtggcgcgacggatcccgcgcaagttcggcctggac
ccgcgcaaggacatccaggtgctcgcgccgatgcaccgggggctggccggcgcgggcgcg
ttgaacgtggtgttgcaggaggcgttgaccccggcggtgaaggacctgccggaacggcgc
ttcggcgggcgggtgttccgggtcggggacaaggtcacgcagatccggaacaactacgac
aagggtgtgaacggcgtcttcaacgggacgttgggcgtggtcacgtccatcgacgtggtg
gagcagaagttgaccgtgaagacggacgaggacgaggacgtggactatgagttcggcgaa
ctggacgaactgacccacgcttacgccatgacgattcatcgctcacagggcagtgagtac
ccgtgcgtggtcattccaatcacgaccagcgcgtggatgatgttgcagcggaacctgctg
tacacggcggtgacgcgggcgaagaagctggtcgtgctggtggggtcgcggaaggcgatc
gggcaggccgtgcgcacggtgggggcggggcggcggcacaccgcgttggactaccggctg
agtcagggctga

DBGET integrated database retrieval system