KEGG   Saccharothrix espanaensis: BN6_75510Help
Entry
BN6_75510         CDS       T02404                                 

Gene name
rfbC3
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
Organism
sesp  Saccharothrix espanaensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
8354205..8354831
Genome map
AA seq 208 aa AA seqDB search
MKARELKIPGAFEFIPSVFPDDRGLFVAPFQEEVFTEAVGHGLLVAQTNHSVSRRGVIRG
LHYADVPPGQAKYVHCPRGRLLDVMVDIRVGSPTFGVWDAVELSEQAFNSVYVPEGVGHA
LMALEDDSVTSYLCTEGYNPKAERGLSPLGLGLPWPADVEPVLSPKDAEAPTLAEAQAAG
TLPSYEVCTAWYRKAAQKVDTQKEDAQK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacgcgagctgaagattcccggcgcgttcgagttcatcccctcggtgttcccc
gacgaccgggggctgttcgtggcgccgttccaggaggaggtgttcaccgaggcggtgggg
cacgggctactggtcgcccagaccaaccacagcgtgtccagacgcggggtgatccgcggc
ctgcactacgcggacgtgccacccggccaggccaagtacgtgcactgcccgcgcgggcgg
ctgctggacgtcatggtggacatccgggtcggctcgccgacgttcggcgtgtgggacgcg
gtggagctctccgagcaggcgttcaactcggtgtacgtgcccgagggcgtcggccacgcg
ctgatggcgctggaggacgactcggtcacgtcgtacctgtgcaccgagggctacaacccg
aaggccgaacgcggcctcagcccgctggggctgggcctgccgtggccggcggacgtggag
ccggtgctgtcgccgaaggacgccgaggccccgaccctggccgaggcccaggccgccggc
acgctgccgtcgtacgaggtgtgcacggcctggtaccggaaagccgcccaaaaggtagac
acccagaaggaagacgcccagaagtag

DBGET integrated database retrieval system