KEGG   Saccharothrix espanaensis: BN6_77380Help
Entry
BN6_77380         CDS       T02404                                 

Gene name
deoA
Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sesp  Saccharothrix espanaensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sesp00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8534911..8536185)
Genome map
AA seq 424 aa AA seqDB search
MTYTAVDVIRAKRDRDALSDAQIDWVVDAYTRGLVADEQMSALAMAIYLNGMDARETARW
TRAMVRSGESLSLDVGRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGG
TLDKLESIPGWRAQLSVAEVTAQLRDVGAVICAATTGLAPADKKLYALRDVTGTVEAIPL
IASSIMSKKIAEGAEALVLDVKVGSGAFMKTETQARALADALVSIGVDHGLKISALLTDM
SVPLGRAVGNAVEVAESVDVLRGGGPADVVELTVALAAEMLHRAGISADPAAVLASGEAY
ETWARMIRAQGGDPEAALPVGGHRHVVEAPDDGVLVALDAYAVGVAAWRLGAGRARKEDP
VQAGAGVLCLAKPGDRVAKGQPLLELHTDTPDALAGALAALTGGYAIGDTAPARPPLVID
VVRG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccgccgtggacgtgatccgggccaagcgggaccgcgacgcgctctccgac
gcccagatcgactgggtggtcgacgcctacaccaggggcctggtcgccgacgagcagatg
tccgcgctcgccatggcgatctacctcaacggcatggacgcccgcgagacggcccgctgg
acccgcgccatggtgcgctccggcgagtcgctctcgctcgacgtcggccggccgaccgtg
gacaagcactcgaccggcggcgtcggcgacaagatcaccctgccgctggccccgctggtc
gcggcgtgcggcgcggccgtgccgcagctgtccgggcgcggcctggggcacaccggcggc
acgctggacaagctggagtccatccccggttggcgggcgcagctgtcggtggccgaggtg
accgcgcagctgcgcgacgtcggcgcggtgatctgcgcggcgaccaccgggctggccccg
gcggacaagaagctctacgcgctgcgggacgtgacggggacggtcgaggccatcccgctg
atcgccagctccatcatgtccaagaagatcgccgagggcgcggaagccctggtgctggac
gtgaaggtcggttccggcgccttcatgaagaccgagacccaggcgcgggcgctggccgac
gcgctggtgtcgatcggcgtggaccacgggctgaagatctccgcgctgctgaccgacatg
tcggtgccgctcgggcgtgcggtcggcaacgcggtcgaggtggccgagtcggtcgacgtg
ctgcgcggcggcgggcccgcggacgtggtggagctgaccgtggcgctggccgcggagatg
ctgcaccgcgccgggatctccgccgacccggccgccgtcctggcctccggcgaggcgtac
gagacgtgggcgcggatgatccgcgcgcagggcggcgacccggaggccgcgttgccggtc
ggcgggcacaggcacgtggtcgaggccccggacgacggtgtgctggtcgcgctggacgcg
tacgccgtgggtgtcgcggcgtggcggctgggtgccggccgggcccgcaaggaggacccg
gtgcaggccggtgccggcgtgctgtgcctggccaagcccggtgaccgggtggcgaagggc
caaccgctgctggagctgcacaccgacacgccggacgccctcgcgggcgcgctggcggcg
ctgaccggcgggtacgcgatcggcgacaccgcgccggcccgtccgccgctggtgatcgac
gtcgtccgaggctga

DBGET integrated database retrieval system