KEGG   Saccharothrix espanaensis: BN6_77480Help
Entry
BN6_77480         CDS       T02404                                 

Definition
(GenBank) putative membrane protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00020  Citrate cycle (TCA cycle)
sesp00190  Oxidative phosphorylation
sesp00650  Butanoate metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01120  Microbial metabolism in diverse environments
sesp01130  Biosynthesis of antibiotics
sesp01200  Carbon metabolism
Module
sesp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sesp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sesp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN6_77480
   00650 Butanoate metabolism
    BN6_77480
  Energy metabolism
   00190 Oxidative phosphorylation
    BN6_77480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CCH34969
UniProt: K0KDV8
Position
8564176..8564586
Genome map
AA seq 136 aa AA seqDB search
MSDLTLDKPRSPRRPAARRSNGELYSWLFMRVSGIALVVLVLGHLFIMNILDGGVHRINF
GFVAGRWASPFWQFWDLAMLWLAQIHGGNGLRTVINDYARKDATRFWLKVLLYVSMVLII
ALGSYVIFTFDPNITS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgaccctggacaagccgcgctccccgcgccgccccgccgcccggcgcagc
aacggcgagctgtacagctggctgttcatgcgcgtgtccggcatcgcgctggtcgtgctg
gtgctcggccacctgttcatcatgaacatcctcgacggcggcgtgcaccggatcaacttc
ggtttcgtggcgggtcgctgggcgtcgccgttctggcagttctgggacctggcgatgctg
tggctggcgcagatccacggcggcaacggcctgcgcaccgtgatcaacgactacgcccgc
aaggacgccacccggttctggctcaaggtgctgctctacgtgtcgatggtgctgatcatc
gccctcggctcgtacgtgatcttcaccttcgacccgaacatcacctcctga

DBGET integrated database retrieval system