KEGG   Saccharothrix espanaensis: BN6_78250Help
Entry
BN6_78250         CDS       T02404                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00020  Citrate cycle (TCA cycle)
sesp00640  Propanoate metabolism
sesp00660  C5-Branched dibasic acid metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01120  Microbial metabolism in diverse environments
sesp01130  Biosynthesis of antibiotics
sesp01200  Carbon metabolism
Module
sesp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sesp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN6_78250 (sucC)
   00640 Propanoate metabolism
    BN6_78250 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN6_78250 (sucC)
Enzymes [BR:sesp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN6_78250 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A HHH_5
Motif
Other DBs
NCBI-ProteinID: CCH35043
UniProt: K0KEV2
Position
complement(8643183..8644454)
Genome map
AA seq 423 aa AA seqDB search
MPGTCGHQAPAWSAGPIEDRTRTRRPTPTSQETRVDLYEYQAKDLFAAHDVPVLPGDVAS
TPAEAKAIAERFGQTVVVKAQVKTGGRGKAGGVKLAETPAETEVKADAILGLDIKGHVVH
RVLVTPASDIAEEYYFSFLLDRANRTFLAMASVEGGMDIEEVAATKPEALAKVPVDAVKG
VDRAKADEIVAAARFPAEVADQVADVIVKLWETFVSEDATLVEVNPLVRDPEGKIVALDG
KVTLDENASFRHPAHEALVDKQAEDPLEAKAKEKGLNYVKLDGQVGIIGNGAGLVMSTLD
VVAYAGEKHKGVKPANFLDIGGGASAEVMANGLDIILHDPDVRSVFVNVFGGITSCDAVA
NGIVAALGILGDQATKPLVVRLDGNNVEEGRRILADAAHPLVTVVDTMDNAADKAAELAA
AGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtacgtgtgggcaccaggctccggcctggagcgccggacctatcgaggaccgc
accaggacgcggcgtccgacaccgacgtcgcaggagacccgagtggacctgtacgagtac
caggcgaaggacctcttcgccgcccacgatgtcccggtgctgccgggcgacgtggccagc
acccccgccgaagccaaggccatcgccgagcgcttcgggcagaccgtcgtcgtcaaggcc
caggtcaagaccggtggccgcggcaaggcgggcggcgtcaagctcgccgagaccccggcc
gagaccgaggtcaaggccgacgcgatcctcggcttggacatcaaggggcacgtcgttcac
cgcgtgctggtgacccccgcgtccgacatcgccgaggagtactacttctccttcctgctc
gaccgcgccaaccgcaccttcctggcgatggcgtccgtcgagggcggcatggacatcgaa
gaggtcgccgcgaccaagcccgaggcactggcgaaggtgcccgtggacgcggtcaagggc
gtcgaccgggcgaaggccgacgagatcgtggccgccgccaggttcccggccgaggtggcc
gaccaggtcgccgacgtcatcgtgaagctctgggagaccttcgtctccgaggacgccacg
ctggtcgaggtcaacccgctggtccgcgaccccgagggcaagatcgtcgccctcgacggc
aaggtcacgctggacgagaacgcctccttccgccaccccgcccacgaggcgctggtggac
aagcaggcggaggacccgctggaggccaaggccaaggagaagggcctcaactacgtcaag
ctggacggccaggtcgggatcatcggcaacggtgccggcctcgtcatgtccacgctggac
gtcgtcgcctacgcgggcgagaagcacaagggcgtcaagcccgcgaacttcctcgacatc
ggcggcggcgcgtccgccgaggtgatggccaacgggctggacatcatcctgcacgacccg
gacgtgcgcagcgtgttcgtgaacgtgttcggcggcatcacctcctgcgacgcggtggcc
aacggcatcgtcgcggcgctgggcatcctgggcgaccaggccaccaagcccctggtggtc
cgcctcgacggcaacaacgtggaggaaggccgccgcatcctcgcggacgccgcccacccg
ctggtgaccgttgtcgacacgatggacaacgcggccgacaaggccgccgagctcgcggct
gcgggggtctga

DBGET integrated database retrieval system