KEGG   Saccharothrix espanaensis: BN6_78250Help
Entry
BN6_78250         CDS       T02404                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sesp  Saccharothrix espanaensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN6_78250 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN6_78250 (sucC)
   00640 Propanoate metabolism
    BN6_78250 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN6_78250 (sucC)
Enzymes [BR:sesp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN6_78250 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(8643183..8644454)
Genome map
AA seq 423 aa AA seqDB search
MPGTCGHQAPAWSAGPIEDRTRTRRPTPTSQETRVDLYEYQAKDLFAAHDVPVLPGDVAS
TPAEAKAIAERFGQTVVVKAQVKTGGRGKAGGVKLAETPAETEVKADAILGLDIKGHVVH
RVLVTPASDIAEEYYFSFLLDRANRTFLAMASVEGGMDIEEVAATKPEALAKVPVDAVKG
VDRAKADEIVAAARFPAEVADQVADVIVKLWETFVSEDATLVEVNPLVRDPEGKIVALDG
KVTLDENASFRHPAHEALVDKQAEDPLEAKAKEKGLNYVKLDGQVGIIGNGAGLVMSTLD
VVAYAGEKHKGVKPANFLDIGGGASAEVMANGLDIILHDPDVRSVFVNVFGGITSCDAVA
NGIVAALGILGDQATKPLVVRLDGNNVEEGRRILADAAHPLVTVVDTMDNAADKAAELAA
AGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtacgtgtgggcaccaggctccggcctggagcgccggacctatcgaggaccgc
accaggacgcggcgtccgacaccgacgtcgcaggagacccgagtggacctgtacgagtac
caggcgaaggacctcttcgccgcccacgatgtcccggtgctgccgggcgacgtggccagc
acccccgccgaagccaaggccatcgccgagcgcttcgggcagaccgtcgtcgtcaaggcc
caggtcaagaccggtggccgcggcaaggcgggcggcgtcaagctcgccgagaccccggcc
gagaccgaggtcaaggccgacgcgatcctcggcttggacatcaaggggcacgtcgttcac
cgcgtgctggtgacccccgcgtccgacatcgccgaggagtactacttctccttcctgctc
gaccgcgccaaccgcaccttcctggcgatggcgtccgtcgagggcggcatggacatcgaa
gaggtcgccgcgaccaagcccgaggcactggcgaaggtgcccgtggacgcggtcaagggc
gtcgaccgggcgaaggccgacgagatcgtggccgccgccaggttcccggccgaggtggcc
gaccaggtcgccgacgtcatcgtgaagctctgggagaccttcgtctccgaggacgccacg
ctggtcgaggtcaacccgctggtccgcgaccccgagggcaagatcgtcgccctcgacggc
aaggtcacgctggacgagaacgcctccttccgccaccccgcccacgaggcgctggtggac
aagcaggcggaggacccgctggaggccaaggccaaggagaagggcctcaactacgtcaag
ctggacggccaggtcgggatcatcggcaacggtgccggcctcgtcatgtccacgctggac
gtcgtcgcctacgcgggcgagaagcacaagggcgtcaagcccgcgaacttcctcgacatc
ggcggcggcgcgtccgccgaggtgatggccaacgggctggacatcatcctgcacgacccg
gacgtgcgcagcgtgttcgtgaacgtgttcggcggcatcacctcctgcgacgcggtggcc
aacggcatcgtcgcggcgctgggcatcctgggcgaccaggccaccaagcccctggtggtc
cgcctcgacggcaacaacgtggaggaaggccgccgcatcctcgcggacgccgcccacccg
ctggtgaccgttgtcgacacgatggacaacgcggccgacaaggccgccgagctcgcggct
gcgggggtctga

DBGET integrated database retrieval system