KEGG   Saccharothrix espanaensis: BN6_78530Help
Entry
BN6_78530         CDS       T02404                                 

Gene name
choD
Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sesp  Saccharothrix espanaensis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8676090..8677808)
Genome map
AA seq 572 aa AA seqDB search
MGELVGNKTDYDVVVVGSGFGGSVAALRLTEKGYRVAVVEAGRRFADDEFAKTSWDLRRY
LWAPALGCYGIQRIHALRNVMILAGAGVGGGSLVYANTLYRPLKPFYNDRQWAHITDWEA
ELAPFYDQASRMLGVVDNPTTTPSDEVMRQVAADLGVADSYRATPVGVFFGEPGKTAEDP
YFGGAGPHRTGCVECGECMTGCRVGAKNTLVKNYLYLAERNGAEVLPLTTVTDLRQAPDG
TWAVATRRTGGRLRKGQRTITAGQVVLAAGTWGTQQLLHRMKAEGVLPRLSAKLGELTRT
NSESIIGAGRFTVDESRNFSQGVAITSSIHPDEQTHIEPVRYGRGSNAMGLLQTLSTDGA
KSTPRVVQFLAQAVRHPVRFFRILSVHRWSERTVILLVMQSLDNSITTFSRKGLFGRKLS
SKQGHGEPNPAFIPAGHAANQSAAKHIGGVAGGTWGELFDIPLTAHFIGGCPIGSDPAAG
VIDPYHRVYGYPGLSVVDGAAISANLGVNPSLTIAAQAERAFSLWPNKGEADGRPEQGAG
YRRVPAVAPAKPAVPTSAPGALRLPIVEVRNS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaactcgtcggtaacaagaccgattacgacgtcgtggtcgtgggttcgggcttc
ggcggcagcgtcgcggccctccggctcaccgagaagggctaccgcgtcgcggtggtcgag
gcgggtcggcggttcgccgacgacgagttcgccaagacctcgtgggacctgcggcgctac
ctgtgggcaccggccctgggctgctacggcatccagcgcatccacgccctgcgcaacgtg
atgatcctggccggcgcgggcgtcggcggcgggtccctggtctacgcgaacaccctctac
cggccgctcaagccgttctacaacgaccggcagtgggcgcacatcaccgactgggaagcc
gagctggcgccgttctacgaccaggccagccggatgctgggcgtggtggacaaccccacg
accacgccgtccgacgaggtcatgaggcaagtcgcggcggacctgggcgtcgctgactcc
taccgcgcgacgccggtcggcgtgttcttcggcgagccgggcaagaccgccgaggacccg
tacttcggcggcgcgggcccgcaccgcaccggctgcgtggagtgcggcgagtgcatgacc
ggctgccgggtcggcgcgaagaacaccctggtcaagaactacctgtacctggccgagcgg
aacggcgcggaggtcctgccgctgaccaccgtcaccgacctgcggcaggccccggacggc
acgtgggcggtggccacccggcgcaccggcggccggctgcgcaagggccagcgcacgatc
accgcgggccaggtcgtgctggccgccggcacgtggggcacccagcagctgctgcaccgg
atgaaggccgagggcgtgctgccccggctgtcggccaagctcggcgagctgacccggacc
aactccgagtcgatcatcggcgcgggccggttcaccgtggacgagagccgcaacttcagc
cagggcgtggcgatcacgtcgtcgatccaccccgacgagcagacccacatcgagccggtg
cgctacggccggggcagcaacgccatgggcctgctccagacgctgtccaccgacggcgcg
aagagcacgccgcgggtggtgcagttcctggcgcaggcggtgcggcacccggtgcggttc
ttccggatcttgtcggtgcaccggtggagcgagcggacggtgatcctgctggtgatgcag
agcctcgacaactccatcaccacgttcagccgcaaggggttgttcggccgcaagctgtcc
tcgaagcagggccacggcgagccgaacccggcgttcatcccggcgggccacgcggcgaac
cagtcggcggccaagcacatcggcggcgtcgccggcgggacctggggcgagctgttcgac
atcccgctgaccgcgcacttcatcggcggctgcccgatcggctcggacccggcggccggc
gtgatcgacccctaccaccgggtctacggctacccgggcctgtcggtggtggacggcgcg
gcgatctcggcgaacctcggggtgaacccgtcgctgaccatcgccgcgcaggccgagcgg
gcgttctcgttgtggcccaacaagggcgaggccgacggccggccggagcagggcgcgggc
taccggcgggtgccggcggtggccccggcgaagcccgccgtgccgacgtccgcgccgggc
gcgctccggctgccgatcgtggaggtcaggaactcctag

DBGET integrated database retrieval system