KEGG   Saccharothrix espanaensis: BN6_78660Help
Entry
BN6_78660         CDS       T02404                                 

Gene name
phoD5
Definition
Alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sesp  Saccharothrix espanaensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN6_78660 (phoD5)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BN6_78660 (phoD5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN6_78660 (phoD5)
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BN6_78660 (phoD5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8689158..8690675
Genome map
AA seq 505 aa AA seqDB search
MTSLTRRTLLIGGAAAGAVLATTGAGSPRLDNPFTLGVASGDPSHDGLVLWTRLAPKPLT
EDGLGGMPNRVVPVHWELAEDERFRRVVRRGVEIARPQSGHSVHVEPFGLRPGREYFYRF
RVDGHVSPTGRTRTAPEPWSIGQDLTMCFVSCAHYGEGYFTAYRRLAEDDPGLVLHLGDY
QYEYAAKAADVRTVVGPETRTLADYRLRHALYKTDPDLQLAHAVAPWAVVWDDHEIENNW
ADEVPEQPDPDFLQRRAAAFQAYYENMPLRRGARPNGVDLQLYRRLRWGNLATFHLLDTR
QYRDDQACGDGWKTCAEAGTPTRTITGAEQERWLLDGFRRSRSRWDVLGQQVFFAERDRK
EGPDKELSMDSWDGYLASRDRITRGWVDARVRNTVVLTGDVHAAYAADVKADWNDPASRT
VGTELVCSSVTSGGDGNDTVDEVQLRLNPHIKLHSRRRGYVRTRFSARQLRADFRALPHV
RTPGAQATTLKSFVVEDRNPGLNPV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacctccctgacccgacggaccctgttgatcggcggcgcggcggccggtgccgtcctg
gccaccaccggggccggctccccccgcctcgacaaccccttcacgctcggcgtggcctcc
ggcgacccgagccacgacggcctggtcctgtggacgcgcctcgcgccgaagccgctgacc
gaggacggcctgggcggcatgccgaaccgcgtggtgccggtgcactgggaactcgccgag
gacgagcggttccggcgggtggtgcggcgcggcgtggagatcgcccgcccgcagtccggg
cacagcgtgcacgtcgagccgttcgggctgcgccccggtcgcgagtacttctaccgcttc
cgggtcgacggccacgtgtcgccgaccggccgcacccgcaccgcgcccgagccgtggtcg
atcggccaggacctgaccatgtgcttcgtgtcctgcgcgcactacggcgagggctacttc
accgcctaccgccggctggccgaggacgacccgggcctggtcctgcacctgggcgactac
cagtacgagtacgcggcgaaggcggccgacgtgcggaccgtcgtcggcccggagacccgc
acgctggccgactaccggctgcggcacgccctgtacaagaccgacccggacctccagctc
gcgcacgccgtcgcgccctgggccgtcgtctgggatgatcatgaaatcgagaacaactgg
gccgacgaggtgcccgagcagcccgaccccgacttcctccagcggcgcgcggcggcgttc
caggcgtactacgagaacatgccgctgcggcgcggtgcccggcccaacggcgtcgacctt
cagctctaccgccggctccggtggggcaacctggccacgttccacctgctcgacacccgc
cagtaccgcgacgaccaggcgtgcggcgacggctggaagacctgcgcggaggccggcacg
ccgacccgcaccatcaccggcgcggagcaggagcggtggctgctcgacgggttccgccgg
tcccggtcgcgctgggacgtgctggggcagcaggtgttcttcgccgagcgcgaccgcaag
gagggcccggacaaggagctgtccatggactcgtgggacggctacctggcctcgcgggac
cggatcacccggggctgggtggacgcgcgggtgcgcaacaccgtcgtgctgaccggtgac
gtgcacgccgcctacgcggccgacgtgaaggccgactggaacgacccggcgtcgcggacc
gtcggcaccgagctggtgtgctcgtcggtcacctccggcggcgatggcaacgacaccgtc
gacgaggtgcagttgcggctcaacccgcacatcaagctgcacagccggcgacgcgggtac
gtgcgcacccggttctccgcccggcagctgcgggccgacttccgcgcgctgccgcacgtg
cggacgccgggcgcgcaggccaccacgctgaagtcgttcgtggtcgaggaccgcaacccg
ggcctgaacccggtctga

DBGET integrated database retrieval system