KEGG   Saccharothrix espanaensis: BN6_80150Help
Entry
BN6_80150         CDS       T02404                                 

Gene name
echA14
Definition
putative enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sesp  Saccharothrix espanaensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN6_80150 (echA14)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN6_80150 (echA14)
   00650 Butanoate metabolism
    BN6_80150 (echA14)
  Lipid metabolism
   00071 Fatty acid degradation
    BN6_80150 (echA14)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN6_80150 (echA14)
   00310 Lysine degradation
    BN6_80150 (echA14)
   00360 Phenylalanine metabolism
    BN6_80150 (echA14)
   00380 Tryptophan metabolism
    BN6_80150 (echA14)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN6_80150 (echA14)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN6_80150 (echA14)
   00281 Geraniol degradation
    BN6_80150 (echA14)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN6_80150 (echA14)
   00627 Aminobenzoate degradation
    BN6_80150 (echA14)
   00930 Caprolactam degradation
    BN6_80150 (echA14)
Enzymes [BR:sesp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN6_80150 (echA14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8828010..8828771
Genome map
AA seq 253 aa AA seqDB search
MSEVLLERSDRVGVITVHDPERRNALTLDLSDQLVAAVKTCEQDADVHAVVVTGAPPAFC
AGADLTALGEAREQGLRRIYAGFLAVADCALPTIAAVGGAAVGAGLNLALACDVRLAGPK
ARFDARFLQLGIHPGGGMTWLLQRLVGPQAATAMTLFGQVLDADAAVRHGLAWDRVDGGH
DELVASAVEFARASAEAPRDLVRTIKATMRTTAVLDAHADAVDTEVVPQVASIETPEFAA
RLAAMKARISGRP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggtgctgctggagcgttccgaccgggtcggcgtgatcaccgtgcacgacccc
gagcggcgcaacgcgttgacgctcgacctgtccgaccaactcgtcgcggccgtcaagacc
tgcgagcaggatgccgatgtccacgccgtggtggtgaccggcgctcccccggcgttctgc
gcgggagccgatctgacggccctgggcgaggcccgggagcaggggctgcggcgcatctac
gccgggttcctcgcggtggcggactgcgcgctgccgacgatcgcggccgtgggcggcgcg
gcggtgggcgcggggctgaacctcgcgctggcctgcgacgtgcggctggccggccccaag
gcgcggttcgacgcgcggttcctccagctgggcatccaccccggcggcgggatgacgtgg
ctgctgcaacgcctggtcggcccgcaggcggcgaccgcgatgacgctgttcgggcaggtc
ctggacgcggacgcggcggtccggcacgggctggcgtgggaccgggtggacggcgggcac
gacgagctggtcgcctcggcggtcgagttcgcgagggcttcggccgaagctccgcgggac
ctggtccgcaccatcaaggccacgatgaggacgacggcggtcctggacgcccacgcggac
gccgtggacaccgaggtcgtcccgcaggtcgcctcgatcgagaccccggagttcgcggcc
aggctggccgcgatgaaggcccggatcagcgggcggccgtga

DBGET integrated database retrieval system