KEGG   Saccharothrix espanaensis: BN6_83080Help
Entry
BN6_83080         CDS       T02404                                 

Definition
Transcriptional regulator, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sesp  Saccharothrix espanaensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN6_83080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN6_83080
   00052 Galactose metabolism
    BN6_83080
   00500 Starch and sucrose metabolism
    BN6_83080
   00520 Amino sugar and nucleotide sugar metabolism
    BN6_83080
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN6_83080
   00524 Butirosin and neomycin biosynthesis
    BN6_83080
Enzymes [BR:sesp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BN6_83080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9115817..9116866
Genome map
AA seq 349 aa AA seqDB search
MSAHRTNPVTGVCQAGAKGGRTCTGWGNRALGIDQWWLDAALSDLVARTRHVIAVDVGGT
ETKAALVAGTALDVRAVRQRRRATTRDAEAVVDDVASLVEDLRAGGDAEIEAVGLVVPGV
VDEDNGIGVYSANLKWQDYPFVKEVEARTGLKTAFGHDVRAGGLAELRIGNARGLQNAVI
MPIGTGIAAALVLDGRIYRGDGSVGEVGHVDVGHGDPCGCGQTGCVEARASSAAIARRYS
ERTGNPVNGAAEVAGLVRAGDPDAVTVWQEAVDALARGILLVAALLGPEAVVLGGGLALA
GPLLVDPLRDRLDGLITFQRRPELRLAALGDEAGCLGAALLAIDMLEER
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgctcaccggacaaatcccgtaacgggtgtctgtcaagcgggtgcgaagggtggg
cggacgtgtaccgggtgggggaatcgggcacttggtatagaccaatggtggttggatgcc
gcactatcggacctcgtggcgcgcactagacacgtgatagccgtcgatgtcggcggtacg
gagaccaaggctgccctggtggccgggacggccctcgacgtccgggcggtccggcaacgg
cggcgggcgacgacccgcgacgccgaggccgtggtcgacgatgtggcctcgctggtcgag
gacctgcgtgccggcggcgacgccgagatcgaggccgtgggcctggtggtgcccggtgtc
gtcgacgaggacaacggcatcggggtgtactccgccaacctcaagtggcaggactacccg
ttcgtgaaggaggtcgaggcccgcaccgggctcaagaccgcgttcgggcacgacgtgcgg
gccggagggctcgccgaactgcgcatcggcaacgccaggggcctgcagaacgccgtgatc
atgccgatcggcaccggcatcgcggcggccctggtcctggacgggcggatctaccgcggc
gacggcagcgtcggcgaggtcgggcacgtcgacgtcgggcacggcgacccgtgcggctgc
ggccagacgggttgtgtcgaagcgcgggcctcctcggcggccatcgcccggcggtattcc
gagcggaccggcaacccggtgaacggggcggcggaggtggccggactggtccgagcgggc
gacccggacgcggtgaccgtgtggcaggaggcggtggacgccctcgcccggggcattctg
ctggtagcggctctactggggcccgaggcggtggtgctcggcggcggactcgcgctggcc
ggcccgctgctggtggacccgttgcgggaccggctggacgggttgatcacgttccagcgg
cgtccggaactgcggctggcggcgctgggcgacgaggccgggtgcctcggggccgcgttg
ctggccatcgacatgctggaggagagatga

DBGET integrated database retrieval system